Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G02850 154 / 1e-49 ARPN plantacyanin (.1) AT1G17800 94 / 2e-25 AtENODL22 early nodulin-like protein 22 (.1) AT5G26330 90 / 2e-23 Cupredoxin superfamily protein (.1) AT3G27200 83 / 8e-21 Cupredoxin superfamily protein (.1) AT3G17675 78 / 1e-19 Cupredoxin superfamily protein (.1) AT2G32300 80 / 4e-19 UCC1 uclacyanin 1 (.1) AT5G07475 79 / 4e-19 Cupredoxin superfamily protein (.1) AT2G26720 77 / 2e-18 Cupredoxin superfamily protein (.1) AT3G60270 76 / 3e-18 Cupredoxin superfamily protein (.1) AT3G60280 76 / 1e-17 UCC3 uclacyanin 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G209300 [exp] 179 / 1e-59 AT2G02850 155 / 4e-50 plantacyanin (.1) Potri.002G241500 [exp] 130 / 6e-40 AT2G02850 122 / 8e-37 plantacyanin (.1) Potri.003G047300 [exp] 96 / 1e-25 AT5G26330 121 / 2e-34 Cupredoxin superfamily protein (.1) Potri.010G089900 [exp] 95 / 2e-25 AT5G26330 187 / 7e-61 Cupredoxin superfamily protein (.1) Potri.007G104600 [exp] 89 / 8e-24 AT1G17800 94 / 3e-25 early nodulin-like protein 22 (.1) Potri.008G151000 [exp] 89 / 5e-23 AT5G26330 183 / 2e-59 Cupredoxin superfamily protein (.1) Potri.013G061300 [exp] 83 / 3e-21 AT3G17675 102 / 1e-28 Cupredoxin superfamily protein (.1) Potri.002G156401 [exp] 82 / 1e-20 AT5G26330 138 / 1e-41 Cupredoxin superfamily protein (.1) Potri.002G156100 [exp] 82 / 1e-20 AT5G26330 138 / 1e-41 Cupredoxin superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028640 [exp] 169 / 2e-55 AT2G02850 151 / 3e-48 plantacyanin (.1) Lus10028641 [exp] 169 / 2e-55 AT2G02850 151 / 3e-48 plantacyanin (.1) Lus10018938 [exp] 167 / 1e-54 AT2G02850 151 / 2e-48 plantacyanin (.1) Lus10041849 [exp] 143 / 3e-45 AT2G02850 130 / 5e-40 plantacyanin (.1) Lus10041848 [exp] 137 / 6e-43 AT2G02850 130 / 4e-40 plantacyanin (.1) Lus10041850 [exp] 137 / 1e-42 AT2G02850 121 / 1e-36 plantacyanin (.1) Lus10022800 [exp] 117 / 4e-35 AT2G02850 100 / 4e-28 plantacyanin (.1) Lus10028395 [exp] 106 / 8e-31 AT2G02850 107 / 2e-31 plantacyanin (.1) Lus10028396 [exp] 105 / 4e-30 AT2G02850 107 / 4e-31 plantacyanin (.1) Lus10011867 [exp] 109 / 1e-28 AT3G07060 621 / 0.0 embryo defective 1974, NHL domain-containing protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0026 [poplar] [flax] CU_oxidase PF02298 [poplar] [flax] Cu_bind_like Plastocyanin-like domain
Representative CDS sequence Show only first row Show all	>Potri.002G074000.1 pacid=42778112 polypeptide=Potri.002G074000.1.p locus=Potri.002G074000 ID=Potri.002G074000.1.v4.1 annot-version=v4.1 ATGGTTCAGGGAAGGGGCAGTGCAGATCTAGTGATGGTTAATGTGGCTGCACTCCTGTGCTTAATGGTTCTCACTGGGCACGTTCACGCAGCAACTTACA CAGTCGGCGGCTCTGGTGGTTGGACCCTTAATATGGATAGTTGGCCGAAAGGCAAGCGCTTTAAAGCTGGTGACACCCTAGTATTCACTTATGATCCAAC GATCCACAATGTGGTGGCCGTGAACAGAGGAGGGTACAGCAGTTGCATCACTCCAGCGGGTGCAAAAGTTTATAAATCAGGAAAAGATCAGATAAAATTA TCAAAGGGACAAAACTTCTTCATTTGCAATGTTGCAGGACACTGTGAATCTGGGATGAAGATTGCTATTAATGCTGCTTGA
AA sequence Show only first row Show all	>Potri.002G074000.1 pacid=42778112 polypeptide=Potri.002G074000.1.p locus=Potri.002G074000 ID=Potri.002G074000.1.v4.1 annot-version=v4.1 MVQGRGSADLVMVNVAALLCLMVLTGHVHAATYTVGGSGGWTLNMDSWPKGKRFKAGDTLVFTYDPTIHNVVAVNRGGYSSCITPAGAKVYKSGKDQIKL SKGQNFFICNVAGHCESGMKIAINAA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G02850		ARPN	plantacyanin (.1)		Potri.002G074000 [exp]	0	1
AT4G24130			Protein of unknown function, D...		Potri.003G146400 [exp]	17.88	0.7311
AT1G31300			TRAM, LAG1 and CLN8 (TLC) lipi...		Potri.012G118100 [exp]	25.37	0.7329
AT5G01075			Glycosyl hydrolase family 35 p...		Potri.014G017600 [exp]	26.83	0.7024
AT4G15802		AtHSBP	Arabidopsis thaliana heat shoc...		Potri.010G025000 [exp]	29.15	0.7175
					Potri.009G037500 [exp]	38.88	0.7189
AT5G48485		DIR1	DEFECTIVE IN INDUCED RESISTANC...		Potri.002G251000 [exp]	39.57	0.6992
AT2G41710	AP2_ERF		Integrase-type DNA-binding sup...		Potri.006G049700 [exp]	41.91	0.7242
AT2G23240		AtMT4b	Arabidopsis thaliana metalloth...		Potri.009G167700 [exp]	46.72	0.6621
AT5G02530			RNA-binding (RRM/RBD/RNP motif...		Potri.008G052601 [exp]	50.26	0.6345
AT1G80500			SNARE-like superfamily protein...		Potri.001G043400 [exp]	51.49	0.6906

Compare expression of checked genes

Potri.002G074000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.