Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	DREB41
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G77640 127 / 3e-36 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT1G21910 124 / 3e-35 AP2_ERF DREB26 dehydration response element-binding protein 26, Integrase-type DNA-binding superfamily protein (.1) AT1G44830 120 / 1e-33 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT1G19210 90 / 2e-22 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT1G74930 90 / 3e-22 AP2_ERF ORA47, ERF018 Integrase-type DNA-binding superfamily protein (.1) AT4G16750 87 / 2e-21 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT5G11590 86 / 3e-20 AP2_ERF DREB3, TINY2 TINY2, Integrase-type DNA-binding superfamily protein (.1) AT2G35700 84 / 5e-20 AP2_ERF ATERF38 ERF family protein 38 (.1) AT2G44940 86 / 7e-20 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT1G77200 84 / 1e-19 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G176000 [exp] 276 / 4e-95 AT1G21910 140 / 3e-41 dehydration response element-binding protein 26, Integrase-type DNA-binding superfamily protein (.1) Potri.006G218200 [exp] 93 / 2e-23 AT1G19210 176 / 4e-56 Integrase-type DNA-binding superfamily protein (.1) Potri.006G138700 [exp] 91 / 1e-22 AT1G19210 174 / 1e-55 Integrase-type DNA-binding superfamily protein (.1) Potri.018G047300 [exp] 89 / 8e-22 AT1G19210 169 / 1e-53 Integrase-type DNA-binding superfamily protein (.1) Potri.018G038100 [exp] 86 / 3e-21 AT5G21960 100 / 5e-27 Integrase-type DNA-binding superfamily protein (.1) Potri.003G079300 [exp] 88 / 4e-21 AT4G16750 150 / 7e-46 Integrase-type DNA-binding superfamily protein (.1) Potri.013G100300 [exp] 85 / 1e-20 AT1G22810 140 / 5e-43 Integrase-type DNA-binding superfamily protein (.1) Potri.006G138800 [exp] 86 / 2e-20 AT1G19210 189 / 3e-61 Integrase-type DNA-binding superfamily protein (.1) Potri.001G155700 [exp] 86 / 2e-20 AT2G44940 159 / 1e-47 Integrase-type DNA-binding superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003740 [exp] 109 / 9e-30 AT1G21910 130 / 4e-38 dehydration response element-binding protein 26, Integrase-type DNA-binding superfamily protein (.1) Lus10028032 [exp] 104 / 2e-28 AT1G21910 117 / 1e-33 dehydration response element-binding protein 26, Integrase-type DNA-binding superfamily protein (.1) Lus10038082 [exp] 89 / 2e-21 AT5G21960 155 / 3e-47 Integrase-type DNA-binding superfamily protein (.1) Lus10002801 [exp] 89 / 3e-21 AT5G11590 209 / 4e-68 TINY2, Integrase-type DNA-binding superfamily protein (.1) Lus10033420 [exp] 87 / 5e-21 AT1G19210 181 / 4e-58 Integrase-type DNA-binding superfamily protein (.1) Lus10009468 [exp] 85 / 7e-21 AT1G22810 132 / 1e-40 Integrase-type DNA-binding superfamily protein (.1) Lus10010043 [exp] 84 / 2e-20 AT2G23340 170 / 1e-54 DREB and EAR motif protein 3 (.1) Lus10034885 [exp] 83 / 2e-19 AT1G19210 172 / 2e-54 Integrase-type DNA-binding superfamily protein (.1) Lus10034949 [exp] 84 / 4e-19 AT4G32800 169 / 3e-51 Integrase-type DNA-binding superfamily protein (.1) Lus10007799 [exp] 80 / 5e-19 AT2G44940 136 / 7e-42 Integrase-type DNA-binding superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0081 [poplar] [flax] MBD-like PF00847 [poplar] [flax] AP2 AP2 domain
Representative CDS sequence Show only first row Show all	>Potri.002G085600.1 pacid=42778477 polypeptide=Potri.002G085600.1.p locus=Potri.002G085600 ID=Potri.002G085600.1.v4.1 annot-version=v4.1 ATGGTGAAGAACGAGCACAAGATCCAGTCAGAGACTTCAACGCCAATGCCAACATCTTCATCAGCATGCAAGAAGAAGAAATACAAGGGAGTTAGAATGA GAAGTTGGGGCTCATGGGTTTCTGAGATAAGGGCACCAAATCAAAAAACAAGAATATGGTTAGGCTCTTATTCAACTCCTGAAGCTGCTGCTAGAGCCTA TGATGCTGCACTTTTATGTCTTAAGGGCTCTTCAGCCAATCTCAACTTTCCTATTACTTCCTCGCATTACATTCCTGACGCTGTGATGTCCCCCAAGTCC ATTCAGAGAGTGGCTGCAGCTGCTGCTAATAGCTCTGAAGACAATCCCACCACCCCTCAAGTATCCTCACTTCCTCTTCCTTCCTCCTCCTCCTCGTCAT CATCATCAATCCTATCATCCCCGTCAATGGTTTCCTCACCGTCCGATCAGCCAGATGATTATATGTCACTAATGGAATCGTTTGAGACCGACAATGAACC AATTCCAATGCTAGATTCTTGGTACAATTTTGATGGATTACAATCACCAAAGTATATTGATCAAATGTTCAATGGGGTCTCATTCAATCCACCGATGATC GATGATTTCTACGAAGGCGATATTCGTCTATGGAGCTTTTCTGAGTAG
AA sequence Show only first row Show all	>Potri.002G085600.1 pacid=42778477 polypeptide=Potri.002G085600.1.p locus=Potri.002G085600 ID=Potri.002G085600.1.v4.1 annot-version=v4.1 MVKNEHKIQSETSTPMPTSSSACKKKKYKGVRMRSWGSWVSEIRAPNQKTRIWLGSYSTPEAAARAYDAALLCLKGSSANLNFPITSSHYIPDAVMSPKS IQRVAAAAANSSEDNPTTPQVSSLPLPSSSSSSSSSILSSPSMVSSPSDQPDDYMSLMESFETDNEPIPMLDSWYNFDGLQSPKYIDQMFNGVSFNPPMI DDFYEGDIRLWSFSE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G77640	AP2_ERF		Integrase-type DNA-binding sup...		Potri.002G085600 [exp]	0	1	DREB41
AT3G21420		LBO1	LATERAL BRANCHING OXIDOREDUCTA...		Potri.010G200900 [exp]	1.41	0.9421
					Potri.017G045000 [exp]	3.74	0.9217
AT1G21910	AP2_ERF	DREB26	dehydration response element-b...		Potri.005G176000 [exp]	3.87	0.9251	DREB39
AT5G25810	AP2_ERF	TNY, TINY	TINY, Integrase-type DNA-bindi...		Potri.019G067400 [exp]	4.47	0.8949
AT5G43066			unknown protein		Potri.014G022000 [exp]	6.92	0.8841
					Potri.001G297101 [exp]	7.34	0.9292
AT3G14470			NB-ARC domain-containing disea...		Potri.017G133600 [exp]	8.00	0.9027
AT5G55050			GDSL-like Lipase/Acylhydrolase...		Potri.005G104900 [exp]	10.58	0.9278
AT1G18740			Protein of unknown function (D...		Potri.005G192600 [exp]	11.40	0.8732
AT1G23710			Protein of unknown function (D...		Potri.010G041300 [exp]	15.19	0.8894

Compare expression of checked genes

Potri.002G085600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.