Potri.002G101200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G72230 129 / 3e-37 Cupredoxin superfamily protein (.1)
AT1G22480 117 / 7e-33 Cupredoxin superfamily protein (.1)
AT2G32300 99 / 1e-24 UCC1 uclacyanin 1 (.1)
AT5G07475 92 / 7e-23 Cupredoxin superfamily protein (.1)
AT3G60270 91 / 2e-22 Cupredoxin superfamily protein (.1)
AT3G27200 89 / 6e-22 Cupredoxin superfamily protein (.1)
AT2G26720 86 / 3e-20 Cupredoxin superfamily protein (.1)
AT2G44790 86 / 3e-20 UCC2 uclacyanin 2 (.1)
AT2G31050 86 / 4e-20 Cupredoxin superfamily protein (.1)
AT3G60280 84 / 2e-19 UCC3 uclacyanin 3 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G101300 301 / 7e-105 AT1G72230 131 / 6e-39 Cupredoxin superfamily protein (.1)
Potri.014G049600 98 / 7e-25 AT3G60270 111 / 8e-31 Cupredoxin superfamily protein (.1)
Potri.003G047300 97 / 2e-24 AT5G26330 121 / 2e-34 Cupredoxin superfamily protein (.1)
Potri.003G150300 96 / 2e-24 AT5G07475 178 / 2e-57 Cupredoxin superfamily protein (.1)
Potri.013G030450 96 / 2e-24 AT3G17675 106 / 2e-30 Cupredoxin superfamily protein (.1)
Potri.013G030000 96 / 3e-24 AT3G17675 106 / 2e-30 Cupredoxin superfamily protein (.1)
Potri.013G061300 92 / 3e-23 AT3G17675 102 / 1e-28 Cupredoxin superfamily protein (.1)
Potri.001G332200 92 / 6e-23 AT3G27200 171 / 5e-55 Cupredoxin superfamily protein (.1)
Potri.003G117900 91 / 2e-22 AT3G17675 108 / 6e-31 Cupredoxin superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020944 161 / 1e-49 AT1G72230 141 / 1e-42 Cupredoxin superfamily protein (.1)
Lus10008720 153 / 2e-46 AT1G72230 140 / 2e-42 Cupredoxin superfamily protein (.1)
Lus10027043 117 / 2e-32 AT1G72230 112 / 4e-31 Cupredoxin superfamily protein (.1)
Lus10025580 112 / 2e-30 AT1G72230 112 / 4e-31 Cupredoxin superfamily protein (.1)
Lus10041570 92 / 1e-22 AT3G27200 167 / 2e-53 Cupredoxin superfamily protein (.1)
Lus10027143 91 / 5e-22 AT2G32300 137 / 9e-40 uclacyanin 1 (.1)
Lus10007025 89 / 1e-21 AT2G32300 101 / 3e-27 uclacyanin 1 (.1)
Lus10006682 87 / 7e-21 AT2G32300 95 / 1e-24 uclacyanin 1 (.1)
Lus10006657 89 / 3e-20 AT1G45063 106 / 1e-26 copper ion binding;electron carriers (.1.2)
Lus10022350 85 / 3e-20 AT3G27200 169 / 7e-54 Cupredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0026 CU_oxidase PF02298 Cu_bind_like Plastocyanin-like domain
Representative CDS sequence
>Potri.002G101200.1 pacid=42777378 polypeptide=Potri.002G101200.1.p locus=Potri.002G101200 ID=Potri.002G101200.1.v4.1 annot-version=v4.1
ATGGAGTATGGGTTAAGTCATCTTCATGAAATTAGTCCCTTTCACATTCTAAGAGCTTTGTGGAATCAAGTGGACCTAATTATACTCACTCCATATTTAC
TCATTCCACTATATAACACCCCCAACGACGATCCTAAAAGCAACCCAAATACCTTCTTCTCTTCTCTTCTTTTCTCCCGGAAAATGGCCGGTTTAATTTC
AAGATCAGTTCCTTGTGCAATCCTAGTAGTCTTGTGCACGGTGGTGCCCATTTTGGCTAAAGATCACACTGTAGGAGATAGTTCAGGCTGGGCAATTGGT
ATGGATTATAGCACCTGGACTAGTGGCAAGACCTTTTCAGTTGGCGACAGCCTTGTGTTTAACTACGGAGGAGGCCACACGGTAGATGAAGTGAGAGCCA
GTGACTACAGCACATGCACTACAGGCAATGCAATCACTTCAGATAGCAGTGGTGCTACCACAATAGCCCTCAAGACTGCCGGAACTCATTATTTCATTTG
TGGTGTTCCTGGCCACTGTGGGAGTGGCATGAAGGTTGCAGTCACTGTTGCAGCAGCAGGATCGAGCACAAGTCCCTCCTCCGGAACTCCATCTTCTGAT
GGCACTACCACTTCTCCGGCCGGTAGTAACGTCACCAATTACAAGCCTTCATCCAACAACGTACCCGATTCATCCTTAGGGATCAATATTTCCCCATTTG
TGGCTTTAGCCGGTACTTGTGTCGCCGTTTTTGTGATGGTTTTCTCATGA
AA sequence
>Potri.002G101200.1 pacid=42777378 polypeptide=Potri.002G101200.1.p locus=Potri.002G101200 ID=Potri.002G101200.1.v4.1 annot-version=v4.1
MEYGLSHLHEISPFHILRALWNQVDLIILTPYLLIPLYNTPNDDPKSNPNTFFSSLLFSRKMAGLISRSVPCAILVVLCTVVPILAKDHTVGDSSGWAIG
MDYSTWTSGKTFSVGDSLVFNYGGGHTVDEVRASDYSTCTTGNAITSDSSGATTIALKTAGTHYFICGVPGHCGSGMKVAVTVAAAGSSTSPSSGTPSSD
GTTTSPAGSNVTNYKPSSNNVPDSSLGINISPFVALAGTCVAVFVMVFS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G72230 Cupredoxin superfamily protein... Potri.002G101200 0 1
AT1G72230 Cupredoxin superfamily protein... Potri.002G101300 1.00 0.9596
AT5G55970 RING/U-box superfamily protein... Potri.011G094800 1.41 0.9358
Potri.005G114500 3.00 0.9320
AT4G15470 Bax inhibitor-1 family protein... Potri.008G199200 4.24 0.8820
AT2G40370 LAC5 laccase 5 (.1) Potri.010G183600 4.47 0.8818
AT2G40370 LAC5 laccase 5 (.1) Potri.008G073700 7.21 0.8766 GLAC90.1
AT5G17420 ATCESA7, MUR10,... MURUS 10, IRREGULAR XYLEM 3, C... Potri.006G181900 12.04 0.8966 Pt-CESA2.1
AT3G61750 Cytochrome b561/ferric reducta... Potri.014G098700 12.32 0.9155
AT3G06035 Glycoprotein membrane precurso... Potri.008G195000 13.26 0.8723
AT1G80280 alpha/beta-Hydrolases superfam... Potri.001G174900 14.96 0.8525

Potri.002G101200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.