Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-DREB1.3,DREB35
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G46768 158 / 3e-50 AP2_ERF RAP2.1 related to AP2 1 (.1) AT5G67190 155 / 7e-49 AP2_ERF DEAR2 DREB and EAR motif protein 2 (.1) AT3G50260 149 / 9e-47 AP2_ERF DEAR1, CEJ1, ATERF#011 DREB AND EAR MOTIF PROTEIN 1, cooperatively regulated by ethylene and jasmonate 1 (.1) AT2G23340 149 / 3e-46 AP2_ERF DEAR3 DREB and EAR motif protein 3 (.1) AT4G36900 148 / 9e-46 AP2_ERF DEAR4, RAP2.10 DREB AND EAR MOTIF PROTEIN 4, related to AP2 10 (.1) AT4G06746 140 / 5e-43 AP2_ERF DEAR5, RAP2.9 DREB AND EAR MOTIF PROTEIN 5, related to AP2 9 (.1) AT1G71450 97 / 6e-26 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT5G11590 95 / 2e-24 AP2_ERF DREB3, TINY2 TINY2, Integrase-type DNA-binding superfamily protein (.1) AT4G16750 93 / 2e-24 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT1G21910 94 / 3e-24 AP2_ERF DREB26 dehydration response element-binding protein 26, Integrase-type DNA-binding superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G025200 [exp] 251 / 6e-87 AT1G46768 160 / 3e-51 related to AP2 1 (.1) Potri.005G140900 [exp] 162 / 2e-51 AT5G67190 169 / 1e-53 DREB and EAR motif protein 2 (.1) Potri.007G046500 [exp] 158 / 7e-50 AT5G67190 149 / 7e-46 DREB and EAR motif protein 2 (.1) Potri.013G101100 [exp] 100 / 4e-27 AT1G71450 184 / 1e-59 Integrase-type DNA-binding superfamily protein (.1) Potri.006G138900 [exp] 96 / 7e-26 AT5G21960 86 / 3e-21 Integrase-type DNA-binding superfamily protein (.1) Potri.003G079300 [exp] 97 / 2e-25 AT4G16750 150 / 7e-46 Integrase-type DNA-binding superfamily protein (.1) Potri.018G047300 [exp] 96 / 2e-25 AT1G19210 169 / 1e-53 Integrase-type DNA-binding superfamily protein (.1) Potri.018G038100 [exp] 95 / 2e-25 AT5G21960 100 / 5e-27 Integrase-type DNA-binding superfamily protein (.1) Potri.001G155700 [exp] 96 / 1e-24 AT2G44940 159 / 1e-47 Integrase-type DNA-binding superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018727 [exp] 191 / 9e-63 AT5G67190 162 / 1e-51 DREB and EAR motif protein 2 (.1) Lus10010043 [exp] 179 / 3e-58 AT2G23340 170 / 1e-54 DREB and EAR motif protein 3 (.1) Lus10009373 [exp] 153 / 5e-48 AT5G67190 164 / 3e-52 DREB and EAR motif protein 2 (.1) Lus10009798 [exp] 97 / 6e-26 AT1G19210 132 / 1e-39 Integrase-type DNA-binding superfamily protein (.1) Lus10038082 [exp] 96 / 6e-25 AT5G21960 155 / 3e-47 Integrase-type DNA-binding superfamily protein (.1) Lus10001601 [exp] 93 / 8e-24 AT5G11590 159 / 1e-48 TINY2, Integrase-type DNA-binding superfamily protein (.1) Lus10033420 [exp] 93 / 9e-24 AT1G19210 181 / 4e-58 Integrase-type DNA-binding superfamily protein (.1) Lus10019665 [exp] 93 / 1e-23 AT4G39780 209 / 1e-67 Integrase-type DNA-binding superfamily protein (.1) Lus10002801 [exp] 92 / 2e-23 AT5G11590 209 / 4e-68 TINY2, Integrase-type DNA-binding superfamily protein (.1) Lus10003581 [exp] 90 / 5e-23 AT2G40340 139 / 6e-42 Integrase-type DNA-binding superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0081 [poplar] [flax] MBD-like PF00847 [poplar] [flax] AP2 AP2 domain
Representative CDS sequence Show only first row Show all	>Potri.002G124000.1 pacid=42777476 polypeptide=Potri.002G124000.1.p locus=Potri.002G124000 ID=Potri.002G124000.1.v4.1 annot-version=v4.1 ATGGAAGGAGAGTGTTATACATCACCAAGTGCTTCAAGTTCAACTCCAACAATATCAAGCATAGGGAAGCGTAAGCATGGTAGGCAACAAAACCAGGAGA AGCCATATAGAGGGATAAGGATGAGGAAGTGGGGTAAGTGGGTAGCTGAAATTAGAGAACCAAACAAGAGGTCTAGGATTTGGCTTGGGTCCTACTCAAC ACCAATTGCTGCAGCTCGTGCATACGACACAGCCGTTTTCTATCTCCGAGGGCCTTCTGTTAGGCTTAATTTCCCTGATTTGATTCACCAAGAAGATGAG TTGTGTGATGTGTCTGCTGCTTCTATACGCAAGAAAGCCACTGAAGTCGGGGCTAAAGTTGATGCCTTGCAAACAGCTCTCCATGCATCACCAGGAGACA ACTCGCCAGCAAATCGACTGTTACTTTCAGAGAAACCTGATTTGAACGAGTACCCAGAGAATTGTGATGAAGAGTGA
AA sequence Show only first row Show all	>Potri.002G124000.1 pacid=42777476 polypeptide=Potri.002G124000.1.p locus=Potri.002G124000 ID=Potri.002G124000.1.v4.1 annot-version=v4.1 MEGECYTSPSASSSTPTISSIGKRKHGRQQNQEKPYRGIRMRKWGKWVAEIREPNKRSRIWLGSYSTPIAAARAYDTAVFYLRGPSVRLNFPDLIHQEDE LCDVSAASIRKKATEVGAKVDALQTALHASPGDNSPANRLLLSEKPDLNEYPENCDEE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G46768	AP2_ERF	RAP2.1	related to AP2 1 (.1)		Potri.002G124000 [exp]	0	1	Pt-DREB1.3,DREB35
AT5G57710			Double Clp-N motif-containing ...		Potri.006G175200 [exp]	4.89	0.7130
AT4G27290			S-locus lectin protein kinase ...		Potri.011G128900 [exp]	6.63	0.6897
AT3G01170			Ribosomal protein L34e superfa...		Potri.004G121900 [exp]	7.41	0.6426
AT4G01000			Ubiquitin-like superfamily pro...		Potri.014G098100 [exp]	8.18	0.7211
AT5G64550			loricrin-related (.1)		Potri.001G206600 [exp]	11.61	0.6943
AT4G19190			zinc knuckle (CCHC-type) famil...		Potri.004G236300 [exp]	19.10	0.6634
AT2G21520			Sec14p-like phosphatidylinosit...		Potri.005G230500 [exp]	21.54	0.6396
AT4G21200		ATGA2OX8	ARABIDOPSIS THALIANA GIBBERELL...		Potri.010G096800 [exp]	22.80	0.6255
AT4G33430		SERK3, RKS10, E...	RECEPTOR KINASES LIKE SERK 10,...		Potri.001G206700 [exp]	25.92	0.6340
AT1G26800			RING/U-box superfamily protein...		Potri.008G087200 [exp]	26.22	0.6486

Compare expression of checked genes

Potri.002G124000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.