Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G01250 177 / 6e-57 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT5G11590 114 / 6e-32 AP2_ERF DREB3, TINY2 TINY2, Integrase-type DNA-binding superfamily protein (.1) AT5G25810 113 / 2e-31 AP2_ERF TNY, TINY TINY, Integrase-type DNA-binding superfamily protein (.1) AT2G36450 110 / 6e-31 AP2_ERF HRD HARDY, Integrase-type DNA-binding superfamily protein (.1) AT2G44940 112 / 2e-30 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT1G71450 109 / 2e-30 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT4G32800 109 / 6e-30 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT4G16750 106 / 4e-29 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT2G35700 105 / 2e-28 AP2_ERF ATERF38 ERF family protein 38 (.1) AT3G60490 103 / 2e-27 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G172200 [exp] 331 / 7e-118 AT1G01250 177 / 6e-57 Integrase-type DNA-binding superfamily protein (.1) Potri.014G099900 [exp] 264 / 3e-91 AT1G01250 191 / 4e-62 Integrase-type DNA-binding superfamily protein (.1) Potri.001G155700 [exp] 118 / 5e-33 AT2G44940 159 / 1e-47 Integrase-type DNA-binding superfamily protein (.1) Potri.003G079300 [exp] 117 / 5e-33 AT4G16750 150 / 7e-46 Integrase-type DNA-binding superfamily protein (.1) Potri.003G050700 [exp] 117 / 6e-33 AT5G11590 166 / 5e-51 TINY2, Integrase-type DNA-binding superfamily protein (.1) Potri.018G043900 [exp] 115 / 8e-32 AT5G11590 212 / 5e-69 TINY2, Integrase-type DNA-binding superfamily protein (.1) Potri.014G055700 [exp] 114 / 1e-31 AT2G44940 206 / 2e-65 Integrase-type DNA-binding superfamily protein (.1) Potri.003G121200 [exp] 110 / 7e-31 AT5G52020 149 / 2e-45 Integrase-type DNA-binding superfamily protein (.1) Potri.013G101100 [exp] 107 / 1e-29 AT1G71450 184 / 1e-59 Integrase-type DNA-binding superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005967 [exp] 130 / 2e-38 AT1G01250 141 / 1e-42 Integrase-type DNA-binding superfamily protein (.1) Lus10002801 [exp] 113 / 3e-31 AT5G11590 209 / 4e-68 TINY2, Integrase-type DNA-binding superfamily protein (.1) Lus10001601 [exp] 109 / 7e-30 AT5G11590 159 / 1e-48 TINY2, Integrase-type DNA-binding superfamily protein (.1) Lus10034949 [exp] 109 / 4e-29 AT4G32800 169 / 3e-51 Integrase-type DNA-binding superfamily protein (.1) Lus10007799 [exp] 104 / 4e-29 AT2G44940 136 / 7e-42 Integrase-type DNA-binding superfamily protein (.1) Lus10004738 [exp] 105 / 1e-28 AT2G35700 144 / 7e-44 ERF family protein 38 (.1) Lus10011123 [exp] 102 / 1e-27 AT5G11590 143 / 6e-43 TINY2, Integrase-type DNA-binding superfamily protein (.1) Lus10038270 [exp] 102 / 3e-27 AT5G11590 168 / 4e-52 TINY2, Integrase-type DNA-binding superfamily protein (.1) Lus10023873 [exp] 100 / 4e-27 AT2G36450 121 / 3e-35 HARDY, Integrase-type DNA-binding superfamily protein (.1) Lus10014376 [exp] 102 / 5e-27 AT2G36450 167 / 2e-52 HARDY, Integrase-type DNA-binding superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0081 [poplar] [flax] MBD-like PF00847 [poplar] [flax] AP2 AP2 domain
Representative CDS sequence Show only first row Show all	>Potri.002G172300.1 pacid=42778851 polypeptide=Potri.002G172300.1.p locus=Potri.002G172300 ID=Potri.002G172300.1.v4.1 annot-version=v4.1 ATGACCCGACTACAAATTCCCGATACTACCCGGGGAAGCGGCAACCGACACCCCGCCTACCGCGGTGTCCGAAAACGGAGGTGGGGAAAATGGGTGTCTG AAATTAGAGAGCCACGCAAGAAATCACGCATTTGGCTAGGCTCATTTCCTGTGCCAGAAATGGCAGCCAAGGCATACGATGTGGCAGCGTATTGTCTTAA AGGTCGCAAAGCGCAGCTCAATTTTCCTGAAGAAGTCGATGACTTGCCTATACCGTCCACGTGTACGGCCAGGGCTATTCAAGCAGCAGCAGCAAAGGCT GCACATTCGGTACTGATTCCAATGAAAAAGAGCAGCGAAACAAACAATGGTGGTGGCAGTGACGGTGAAGTTGCTGGTGATGATTTCTGGGGCGAGATTG AATTGCCGGAGTTGCTGCTGAGTAATAGCGGGTACAGTTGGGATTCTTGTGGATGGAATACTACTCTTGCAAGTGATAATTCAACGTGGCAGCCGGATGG AGAGGGTCTACAGCCATCCATGGCATGTCTTTAA
AA sequence Show only first row Show all	>Potri.002G172300.1 pacid=42778851 polypeptide=Potri.002G172300.1.p locus=Potri.002G172300 ID=Potri.002G172300.1.v4.1 annot-version=v4.1 MTRLQIPDTTRGSGNRHPAYRGVRKRRWGKWVSEIREPRKKSRIWLGSFPVPEMAAKAYDVAAYCLKGRKAQLNFPEEVDDLPIPSTCTARAIQAAAAKA AHSVLIPMKKSSETNNGGGSDGEVAGDDFWGEIELPELLLSNSGYSWDSCGWNTTLASDNSTWQPDGEGLQPSMACL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G01250	AP2_ERF		Integrase-type DNA-binding sup...		Potri.002G172300 [exp]	0	1
AT1G02205		CER1	ECERIFERUM 1, Fatty acid hydro...		Potri.014G152900 [exp]	2.44	0.9728
AT5G17540			HXXXD-type acyl-transferase fa...		Potri.013G074400 [exp]	2.44	0.9762
AT1G44000			unknown protein		Potri.002G075700 [exp]	4.12	0.9474
AT5G62360			Plant invertase/pectin methyle...		Potri.015G128200 [exp]	6.92	0.9598
AT3G03620			MATE efflux family protein (.1...		Potri.013G069250 [exp]	10.19	0.9563
AT5G01870			Bifunctional inhibitor/lipid-t...		Potri.016G135800 [exp]	12.84	0.9559
AT1G01250	AP2_ERF		Integrase-type DNA-binding sup...		Potri.002G172200 [exp]	13.41	0.9410
					Potri.004G213900 [exp]	19.44	0.9524
					Potri.005G228550 [exp]	22.04	0.9426
AT5G57800		CER3, FLP1, YRE...	FACELESS POLLEN 1, ECERIFERUM ...		Potri.006G177500 [exp]	24.89	0.9462

Compare expression of checked genes

Potri.002G172300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.