Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G62840 204 / 4e-70 Small nuclear ribonucleoprotein family protein (.1.2) AT2G47640 204 / 4e-70 Small nuclear ribonucleoprotein family protein (.1.2.3.4) AT1G76860 54 / 2e-10 Small nuclear ribonucleoprotein family protein (.1) AT1G21190 52 / 5e-10 Small nuclear ribonucleoprotein family protein (.1) AT4G20440 41 / 4e-05 SMB small nuclear ribonucleoprotein associated protein B (.1.2.3.4) AT5G44500 40 / 6e-05 Small nuclear ribonucleoprotein family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G129100 [exp] 221 / 9e-77 AT3G62840 204 / 6e-70 Small nuclear ribonucleoprotein family protein (.1.2) Potri.014G045700 [exp] 56 / 2e-11 AT3G62840 54 / 5e-11 Small nuclear ribonucleoprotein family protein (.1.2) Potri.002G068800 [exp] 52 / 9e-10 AT1G76860 175 / 1e-58 Small nuclear ribonucleoprotein family protein (.1) Potri.005G191600 [exp] 52 / 1e-09 AT1G76860 176 / 3e-59 Small nuclear ribonucleoprotein family protein (.1) Potri.011G155700 [exp] 42 / 3e-05 AT4G20440 218 / 2e-70 small nuclear ribonucleoprotein associated protein B (.1.2.3.4) Potri.001G440100 [exp] 42 / 3e-05 AT4G20440 211 / 2e-67 small nuclear ribonucleoprotein associated protein B (.1.2.3.4)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030367 [exp] 198 / 1e-67 AT2G47640 185 / 2e-62 Small nuclear ribonucleoprotein family protein (.1.2.3.4) Lus10007876 [exp] 198 / 1e-67 AT2G47640 185 / 2e-62 Small nuclear ribonucleoprotein family protein (.1.2.3.4) Lus10026556 [exp] 196 / 7e-67 AT2G47640 184 / 3e-62 Small nuclear ribonucleoprotein family protein (.1.2.3.4) Lus10013840 [exp] 196 / 7e-67 AT2G47640 184 / 3e-62 Small nuclear ribonucleoprotein family protein (.1.2.3.4) Lus10011293 [exp] 50 / 7e-09 AT1G76860 175 / 8e-59 Small nuclear ribonucleoprotein family protein (.1) Lus10040487 [exp] 50 / 7e-09 AT1G76860 175 / 8e-59 Small nuclear ribonucleoprotein family protein (.1) Lus10026326 [exp] 49 / 7e-09 AT1G76860 176 / 4e-59 Small nuclear ribonucleoprotein family protein (.1) Lus10042341 [exp] 40 / 4e-05 AT1G76860 132 / 2e-41 Small nuclear ribonucleoprotein family protein (.1) Lus10023386 [exp] 41 / 6e-05 AT5G44500 259 / 5e-87 Small nuclear ribonucleoprotein family protein (.1.2) Lus10038421 [exp] 40 / 7e-05 AT5G44500 263 / 2e-88 Small nuclear ribonucleoprotein family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0527 [poplar] [flax] Sm-like PF01423 [poplar] [flax] LSM LSM domain
Representative CDS sequence Show only first row Show all	>Potri.002G204300.1 pacid=42779736 polypeptide=Potri.002G204300.1.p locus=Potri.002G204300 ID=Potri.002G204300.1.v4.1 annot-version=v4.1 ATGAGTAGGCCAATGGAAGAGGATGCCCCGAGCAAGAACGAGGAGGAGGAATTCAGCACTGGGCCACTCTCTGTTCTGATGATGAGTGTAAAAAATAATA CCCAGGTATTAATTAACTGCCGCAACAACAAGAAGCTTCTTGGACGTGTGAGGGCATTTGATAGACATTGCAACATGGTTCTTGAGAATGTCAGGGAAAT GTGGACTGAGGTGCCAAAAACCGGGAAAGGCAAGAAGAAAGCTCAGCCAGTCAACAAAGATAGGTTCATCAGCAAAATGTTCCTCCGTGGTGATTCTGTT ATCATTGTCCTTAGGAATCCTAAGTGA
AA sequence Show only first row Show all	>Potri.002G204300.1 pacid=42779736 polypeptide=Potri.002G204300.1.p locus=Potri.002G204300 ID=Potri.002G204300.1.v4.1 annot-version=v4.1 MSRPMEEDAPSKNEEEEFSTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENVREMWTEVPKTGKGKKKAQPVNKDRFISKMFLRGDSV IIVLRNPK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G62840			Small nuclear ribonucleoprotei...		Potri.002G204300 [exp]	0	1
AT4G29170		ATMND1	Mnd1 family protein (.1.2)		Potri.018G069800 [exp]	1.41	0.8004
AT5G60340			P-loop containing nucleoside t...		Potri.012G109400 [exp]	3.00	0.8066
AT1G63270		ABCI1, ATNAP10	ATP-binding cassette I1, non-i...		Potri.018G110200 [exp]	4.47	0.7308	ATNAP10.1
AT5G13780			Acyl-CoA N-acyltransferases (N...		Potri.001G261800 [exp]	6.48	0.7639
AT5G22280			unknown protein		Potri.016G073500 [exp]	7.74	0.7667
AT4G02485			2-oxoglutarate (2OG) and Fe(II...		Potri.014G131200 [exp]	11.83	0.7255
AT1G10865			unknown protein		Potri.008G010300 [exp]	12.96	0.7019
AT4G20150			unknown protein		Potri.003G156301 [exp]	13.60	0.7661
AT5G27990			Pre-rRNA-processing protein TS...		Potri.013G035000 [exp]	15.09	0.7726
AT3G06060		TSC10A	TSC10A, NAD(P)-binding Rossman...		Potri.010G191800 [exp]	18.70	0.7492

Compare expression of checked genes

Potri.002G204300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.