Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G02850 122 / 7e-37 ARPN plantacyanin (.1) AT3G60270 83 / 1e-20 Cupredoxin superfamily protein (.1) AT2G31050 82 / 2e-20 Cupredoxin superfamily protein (.1) AT5G26330 82 / 3e-20 Cupredoxin superfamily protein (.1) AT2G32300 82 / 1e-19 UCC1 uclacyanin 1 (.1) AT3G17675 77 / 4e-19 Cupredoxin superfamily protein (.1) AT5G07475 78 / 6e-19 Cupredoxin superfamily protein (.1) AT2G26720 77 / 3e-18 Cupredoxin superfamily protein (.1) AT2G44790 74 / 3e-17 UCC2 uclacyanin 2 (.1) AT3G27200 73 / 4e-17 Cupredoxin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G209300 [exp] 133 / 3e-41 AT2G02850 155 / 4e-50 plantacyanin (.1) Potri.002G074000 [exp] 130 / 6e-40 AT2G02850 154 / 1e-49 plantacyanin (.1) Potri.007G104600 [exp] 99 / 1e-27 AT1G17800 94 / 3e-25 early nodulin-like protein 22 (.1) Potri.006G259101 [exp] 91 / 5e-24 AT5G26330 142 / 2e-43 Cupredoxin superfamily protein (.1) Potri.003G047300 [exp] 91 / 2e-23 AT5G26330 121 / 2e-34 Cupredoxin superfamily protein (.1) Potri.006G259000 [exp] 89 / 2e-23 AT5G26330 144 / 6e-44 Cupredoxin superfamily protein (.1) Potri.002G161300 [exp] 89 / 4e-23 AT5G26330 146 / 5e-45 Cupredoxin superfamily protein (.1) Potri.002G156100 [exp] 88 / 5e-23 AT5G26330 138 / 1e-41 Cupredoxin superfamily protein (.1) Potri.002G156401 [exp] 88 / 5e-23 AT5G26330 138 / 1e-41 Cupredoxin superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041849 [exp] 140 / 6e-44 AT2G02850 130 / 5e-40 plantacyanin (.1) Lus10022800 [exp] 136 / 2e-42 AT2G02850 100 / 4e-28 plantacyanin (.1) Lus10041850 [exp] 130 / 3e-40 AT2G02850 121 / 1e-36 plantacyanin (.1) Lus10041848 [exp] 124 / 1e-37 AT2G02850 130 / 4e-40 plantacyanin (.1) Lus10018938 [exp] 122 / 7e-37 AT2G02850 151 / 2e-48 plantacyanin (.1) Lus10011867 [exp] 132 / 1e-36 AT3G07060 621 / 0.0 embryo defective 1974, NHL domain-containing protein (.1) Lus10028640 [exp] 120 / 3e-36 AT2G02850 151 / 3e-48 plantacyanin (.1) Lus10028641 [exp] 120 / 3e-36 AT2G02850 151 / 3e-48 plantacyanin (.1) Lus10028396 [exp] 107 / 1e-30 AT2G02850 107 / 4e-31 plantacyanin (.1) Lus10028395 [exp] 103 / 1e-29 AT2G02850 107 / 2e-31 plantacyanin (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0026 [poplar] [flax] CU_oxidase PF02298 [poplar] [flax] Cu_bind_like Plastocyanin-like domain
Representative CDS sequence Show only first row Show all	>Potri.002G241500.1 pacid=42776778 polypeptide=Potri.002G241500.1.p locus=Potri.002G241500 ID=Potri.002G241500.1.v4.1 annot-version=v4.1 ATGGCTCGCCAGGGAAGATGCAGTGCGATCGGCGTAGTTCTGGCTAGTACCCTTCTTGTCATTCTATCACTCCAATTCAAGATCGCCATCGCCAAGGCAG CTACTTTCACCGTCGGTGACACCTCAGGCTGGACTTTCAACATCCAGAGTTGGACAGATGGGAAAAAGTTCAAGGCCGGCGACAGCCTGATTTTCAACTA CGATCCTTCATTGCATGATGTGGCCACTGTAGATGTCGATGGCTACGATGGCTGCACACTTTCTCCGAGCTCCAGCACTTACACAAGTGGAAAAGATACG ATCAAGCTGAAGGAGGGACAAAACTATTTTATATGCAGTCTCCCCAGTCACTGTGACTGGGGGTTGAAAATTGCAGTCAATGCTTCCGCCTAG
AA sequence Show only first row Show all	>Potri.002G241500.1 pacid=42776778 polypeptide=Potri.002G241500.1.p locus=Potri.002G241500 ID=Potri.002G241500.1.v4.1 annot-version=v4.1 MARQGRCSAIGVVLASTLLVILSLQFKIAIAKAATFTVGDTSGWTFNIQSWTDGKKFKAGDSLIFNYDPSLHDVATVDVDGYDGCTLSPSSSTYTSGKDT IKLKEGQNYFICSLPSHCDWGLKIAVNASA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G02850		ARPN	plantacyanin (.1)		Potri.002G241500 [exp]	0	1
					Potri.013G045500 [exp]	4.12	0.9355
					Potri.003G103100 [exp]	6.92	0.9058
AT3G14620		CYP72A8	"cytochrome P450, family 72, s...		Potri.010G139500 [exp]	8.83	0.9270
AT1G11310		PMR2, ATMLO2, M...	POWDERY MILDEW RESISTANT 2, MI...		Potri.002G007000 [exp]	9.32	0.9264
AT1G22340		ATUGT85A7	UDP-glucosyl transferase 85A7 ...		Potri.007G095000 [exp]	9.89	0.9089
AT3G07040		RPS3, RPM1	RESISTANCE TO PSEUDOMONAS SYRI...		Potri.001G134475 [exp]	13.11	0.9174
					Potri.015G139966 [exp]	14.83	0.8363
AT2G45220			Plant invertase/pectin methyle...		Potri.015G127700 [exp]	18.30	0.9096	Pt-PME.5
AT3G07040		RPS3, RPM1	RESISTANCE TO PSEUDOMONAS SYRI...		Potri.001G134400 [exp]	18.33	0.9092
AT3G03450	GRAS	RGL2	RGA-like 2 (.1)		Potri.010G143500 [exp]	26.98	0.8979

Compare expression of checked genes

Potri.002G241500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.