Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G15360 181 / 3e-58 AP2_ERF WIN1, SHN1 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) AT5G11190 162 / 5e-51 AP2_ERF SHN2, SHN3 shine2, Integrase-type DNA-binding superfamily protein (.1) AT5G25390 161 / 9e-51 AP2_ERF SHN3, SHN2 shine3, Integrase-type DNA-binding superfamily protein (.1.2) AT5G25190 85 / 7e-21 AP2_ERF ESE3 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) AT4G13620 69 / 4e-14 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT1G36060 68 / 6e-14 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT4G11140 68 / 6e-14 AP2_ERF CRF1 cytokinin response factor 1 (.1) AT1G71450 67 / 6e-14 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT5G53290 68 / 1e-13 AP2_ERF CRF3 cytokinin response factor 3 (.1) AT2G22200 67 / 1e-13 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G069400 [exp] 183 / 6e-59 AT1G15360 186 / 9e-60 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Potri.018G131400 [exp] 183 / 6e-59 AT1G15360 194 / 6e-63 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Potri.018G028000 [exp] 171 / 8e-55 AT5G11190 204 / 8e-68 shine2, Integrase-type DNA-binding superfamily protein (.1) Potri.006G253800 [exp] 162 / 9e-51 AT5G11190 197 / 1e-64 shine2, Integrase-type DNA-binding superfamily protein (.1) Potri.018G021900 [exp] 86 / 6e-21 AT5G25190 169 / 1e-53 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Potri.006G261200 [exp] 86 / 6e-21 AT5G25190 169 / 9e-54 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Potri.001G048200 [exp] 84 / 2e-20 AT5G25190 162 / 5e-51 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Potri.013G158500 [exp] 71 / 1e-14 AT4G27950 124 / 1e-32 cytokinin response factor 4 (.1) Potri.017G055400 [exp] 69 / 4e-14 AT4G13620 216 / 9e-66 Integrase-type DNA-binding superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005716 [exp] 187 / 2e-60 AT1G15360 236 / 3e-79 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10030097 [exp] 184 / 4e-59 AT1G15360 234 / 1e-78 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10009480 [exp] 177 / 5e-57 AT1G15360 207 / 1e-68 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10019414 [exp] 160 / 6e-50 AT1G15360 207 / 1e-67 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10002015 [exp] 141 / 9e-43 AT1G15360 183 / 4e-59 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10002912 [exp] 141 / 1e-42 AT5G25390 187 / 6e-61 shine3, Integrase-type DNA-binding superfamily protein (.1.2) Lus10043271 [exp] 115 / 5e-32 AT1G15360 160 / 2e-49 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10003506 [exp] 100 / 2e-27 AT1G15360 105 / 3e-29 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10041023 [exp] 82 / 8e-20 AT5G25190 205 / 7e-68 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Lus10035859 [exp] 81 / 4e-19 AT5G25190 196 / 9e-65 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0081 [poplar] [flax] MBD-like PF00847 [poplar] [flax] AP2 AP2 domain
Representative CDS sequence Show only first row Show all	>Potri.003G033000.1 pacid=42787135 polypeptide=Potri.003G033000.1.p locus=Potri.003G033000 ID=Potri.003G033000.1.v4.1 annot-version=v4.1 ATGGTACAATCAAAGAAGTTCAGAGGTGTCAGGCAACGCCACTGGGGCTCATGGGTGTCTGAGATTCGTCATCCTTTACTAAAAAGAAGGGTGTGGCTTG GAACATTTGATACGGCTGAAGAGGCAGCAAGAGCCTACGATGAAGCAGCGATTTTGATGAGTGGCCGTAACGCCAAAACAAACTTCCCTGTGGTTGCAAA TCAAACAAGAAATGGTCAGAACTCTCCCTCCTCCTCGTCAGCTCTTAGTGCAAAACTACGCAAATATTGCAGATCTCCATATCCTTCCCTAACTTGTCTA AGGCTTGACGCCGAGAATTGCCACATTGGAGTCTGGCAAAAGCGTGCCGGTCCACGTTCGGTTTCAAATTGGATTATGACTGTAGAGCTTGGAAAGAAGG ATGGACGGCAAGCCCCGGAACAAAAGATTCTCATCTCAGATACATCAGATATGGCAGGCCAAGAAGGTGGTAGTGATGATGGTCCAGATGACGAGGAAAG GGTTGCATTGCAGATGATAGAGGAGCTACTTAACAGGTAG
AA sequence Show only first row Show all	>Potri.003G033000.1 pacid=42787135 polypeptide=Potri.003G033000.1.p locus=Potri.003G033000 ID=Potri.003G033000.1.v4.1 annot-version=v4.1 MVQSKKFRGVRQRHWGSWVSEIRHPLLKRRVWLGTFDTAEEAARAYDEAAILMSGRNAKTNFPVVANQTRNGQNSPSSSSALSAKLRKYCRSPYPSLTCL RLDAENCHIGVWQKRAGPRSVSNWIMTVELGKKDGRQAPEQKILISDTSDMAGQEGGSDDGPDDEERVALQMIEELLNR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G15360	AP2_ERF	WIN1, SHN1	WAX INDUCER 1, SHINE 1, Integr...		Potri.003G033000 [exp]	0	1
AT4G20790			Leucine-rich repeat protein ki...		Potri.011G157600 [exp]	37.14	0.6746
AT3G51070			S-adenosyl-L-methionine-depend...		Potri.005G118100 [exp]	102.12	0.6239
AT4G37260	MYB	ATMYB73	myb domain protein 73 (.1)		Potri.008G070900 [exp]	222.68	0.5748

Compare expression of checked genes

Potri.003G033000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.