Potri.003G047300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G31050 123 / 5e-35 Cupredoxin superfamily protein (.1)
AT5G26330 122 / 9e-35 Cupredoxin superfamily protein (.1)
AT2G26720 112 / 1e-30 Cupredoxin superfamily protein (.1)
AT2G32300 111 / 9e-30 UCC1 uclacyanin 1 (.1)
AT3G60270 100 / 3e-26 Cupredoxin superfamily protein (.1)
AT3G27200 90 / 3e-22 Cupredoxin superfamily protein (.1)
AT4G31840 89 / 5e-22 AtENODL15 early nodulin-like protein 15 (.1)
AT3G17675 87 / 5e-22 Cupredoxin superfamily protein (.1)
AT1G72230 89 / 9e-22 Cupredoxin superfamily protein (.1)
AT3G20570 89 / 1e-21 AtENODL9 early nodulin-like protein 9 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G161300 147 / 6e-45 AT5G26330 146 / 5e-45 Cupredoxin superfamily protein (.1)
Potri.006G259000 141 / 2e-42 AT5G26330 144 / 6e-44 Cupredoxin superfamily protein (.1)
Potri.006G259101 139 / 1e-41 AT5G26330 142 / 2e-43 Cupredoxin superfamily protein (.1)
Potri.001G268700 137 / 4e-41 AT5G26330 138 / 6e-42 Cupredoxin superfamily protein (.1)
Potri.002G156401 135 / 2e-40 AT5G26330 138 / 1e-41 Cupredoxin superfamily protein (.1)
Potri.002G156100 135 / 2e-40 AT5G26330 138 / 1e-41 Cupredoxin superfamily protein (.1)
Potri.002G052500 130 / 5e-38 AT5G26330 130 / 9e-39 Cupredoxin superfamily protein (.1)
Potri.010G089900 126 / 2e-36 AT5G26330 187 / 7e-61 Cupredoxin superfamily protein (.1)
Potri.008G151000 123 / 4e-35 AT5G26330 183 / 2e-59 Cupredoxin superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021925 120 / 8e-34 AT5G26330 170 / 5e-54 Cupredoxin superfamily protein (.1)
Lus10041211 118 / 4e-33 AT5G26330 167 / 6e-53 Cupredoxin superfamily protein (.1)
Lus10010533 114 / 8e-32 AT5G26330 174 / 1e-55 Cupredoxin superfamily protein (.1)
Lus10041570 102 / 3e-27 AT3G27200 167 / 2e-53 Cupredoxin superfamily protein (.1)
Lus10008720 102 / 7e-27 AT1G72230 140 / 2e-42 Cupredoxin superfamily protein (.1)
Lus10041850 97 / 8e-26 AT2G02850 121 / 1e-36 plantacyanin (.1)
Lus10002614 97 / 1e-25 AT2G32300 100 / 1e-26 uclacyanin 1 (.1)
Lus10020944 98 / 3e-25 AT1G72230 141 / 1e-42 Cupredoxin superfamily protein (.1)
Lus10022350 97 / 5e-25 AT3G27200 169 / 7e-54 Cupredoxin superfamily protein (.1)
Lus10027143 97 / 2e-24 AT2G32300 137 / 9e-40 uclacyanin 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0026 CU_oxidase PF02298 Cu_bind_like Plastocyanin-like domain
Representative CDS sequence
>Potri.003G047300.1 pacid=42785388 polypeptide=Potri.003G047300.1.p locus=Potri.003G047300 ID=Potri.003G047300.1.v4.1 annot-version=v4.1
ATGGCAAAGATAGCAGTTGCTCTGTTCATGATGATGGCTCTTTGTGGAGTTTGTTTTGGTGCTGGCTACAATGTTGGTGAATCGGATGGCTGGACCATTG
GAGTCGATTATAACCAGTGGGCTTCTACCAAGAAATTCCAAGTTGGTGACACTCTTGTTTTCAATTACAATACCATGTTTCACAATGTGTTGCAAGTGAC
CAAACAAGACTACGAATCTTGCAATGTCAAATCCCCAGTCGCCACCTTTGCTAGTGGCAGAGACTTCATCACCCTCGACAAAGCAGGCCACTCGTACTTC
GTGTGTGGTTTTCCTGGTCATTGCCAAGCGGGACTCAAGGTTGCTATCTCAGTCAGGGCGTCATCTTCTCAGAGCCCAGATGTTCCAAGCCCCCCTTCTA
CACCAAGAGAGATTCCTCCTCCCCCTCCTCCTCAAACCCTTAGTGCTCCTGGTCAACCTAATTTTCATCCACCACCATTAGGGTCTCCAAACGTGCCTCT
TCCACCAGGCTTCCCAAATTTTGGGACGCCTTCAGGACCTGGCTTTCCTTATTTGCCTCCTTTCGAAAGTGGTGCATCTCTCCATTCCTCTAACCTCAAG
GCAGCAATGTTGAGTGTCATCATGACTAATTTATTTGCTGTTTTTGCGTATTGA
AA sequence
>Potri.003G047300.1 pacid=42785388 polypeptide=Potri.003G047300.1.p locus=Potri.003G047300 ID=Potri.003G047300.1.v4.1 annot-version=v4.1
MAKIAVALFMMMALCGVCFGAGYNVGESDGWTIGVDYNQWASTKKFQVGDTLVFNYNTMFHNVLQVTKQDYESCNVKSPVATFASGRDFITLDKAGHSYF
VCGFPGHCQAGLKVAISVRASSSQSPDVPSPPSTPREIPPPPPPQTLSAPGQPNFHPPPLGSPNVPLPPGFPNFGTPSGPGFPYLPPFESGASLHSSNLK
AAMLSVIMTNLFAVFAY

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G26330 Cupredoxin superfamily protein... Potri.003G047300 0 1

Potri.003G047300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.