Potri.003G054100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G71450 144 / 7e-44 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT1G33760 135 / 3e-40 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT1G01250 104 / 4e-28 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT5G11590 104 / 8e-28 AP2_ERF DREB3, TINY2 TINY2, Integrase-type DNA-binding superfamily protein (.1)
AT4G16750 102 / 1e-27 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT2G35700 100 / 9e-27 AP2_ERF ATERF38 ERF family protein 38 (.1)
AT5G25810 100 / 2e-26 AP2_ERF TNY, TINY TINY, Integrase-type DNA-binding superfamily protein (.1)
AT3G16280 98 / 2e-25 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT2G36450 97 / 2e-25 AP2_ERF HRD HARDY, Integrase-type DNA-binding superfamily protein (.1)
AT2G44940 99 / 5e-25 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G075600 223 / 6e-75 AT1G33760 147 / 6e-45 Integrase-type DNA-binding superfamily protein (.1)
Potri.013G101200 213 / 9e-71 AT1G33760 149 / 1e-45 Integrase-type DNA-binding superfamily protein (.1)
Potri.013G101100 162 / 8e-51 AT1G71450 184 / 1e-59 Integrase-type DNA-binding superfamily protein (.1)
Potri.001G181500 145 / 2e-44 AT1G71450 184 / 8e-60 Integrase-type DNA-binding superfamily protein (.1)
Potri.019G075500 140 / 3e-42 AT1G71450 200 / 5e-66 Integrase-type DNA-binding superfamily protein (.1)
Potri.003G079300 105 / 2e-28 AT4G16750 150 / 7e-46 Integrase-type DNA-binding superfamily protein (.1)
Potri.002G172200 104 / 2e-28 AT1G01250 177 / 6e-57 Integrase-type DNA-binding superfamily protein (.1)
Potri.003G050700 105 / 4e-28 AT5G11590 166 / 5e-51 TINY2, Integrase-type DNA-binding superfamily protein (.1)
Potri.014G099900 104 / 4e-28 AT1G01250 191 / 4e-62 Integrase-type DNA-binding superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041052 150 / 4e-46 AT1G33760 143 / 3e-43 Integrase-type DNA-binding superfamily protein (.1)
Lus10002953 124 / 7e-36 AT1G33760 143 / 2e-43 Integrase-type DNA-binding superfamily protein (.1)
Lus10041050 114 / 4e-32 AT1G71450 189 / 1e-61 Integrase-type DNA-binding superfamily protein (.1)
Lus10003513 109 / 3e-30 AT1G33760 140 / 2e-42 Integrase-type DNA-binding superfamily protein (.1)
Lus10007799 100 / 3e-27 AT2G44940 136 / 7e-42 Integrase-type DNA-binding superfamily protein (.1)
Lus10004738 102 / 4e-27 AT2G35700 144 / 7e-44 ERF family protein 38 (.1)
Lus10006173 100 / 9e-27 AT1G71450 167 / 4e-53 Integrase-type DNA-binding superfamily protein (.1)
Lus10034949 102 / 2e-26 AT4G32800 169 / 3e-51 Integrase-type DNA-binding superfamily protein (.1)
Lus10002801 100 / 6e-26 AT5G11590 209 / 4e-68 TINY2, Integrase-type DNA-binding superfamily protein (.1)
Lus10011123 98 / 8e-26 AT5G11590 143 / 6e-43 TINY2, Integrase-type DNA-binding superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0081 MBD-like PF00847 AP2 AP2 domain
Representative CDS sequence
>Potri.003G054100.1 pacid=42784801 polypeptide=Potri.003G054100.1.p locus=Potri.003G054100 ID=Potri.003G054100.1.v4.1 annot-version=v4.1
ATGGAAGGAAGAAGCAGGGACGCCCATGCTGATCAGATTAGTACTCCGAGATATCGAGGTATTCGGCAAAGAAAATGGGGGACATGGGTGTCCGAAATCC
GGGAGCCTGGTCAGAAAACAAGAATTTGGCTCGGAAGTTATGAGAAGCCTGAAATGGCTGCGGTCGCGTATGATGTGGCAGCATTGCACCTTAGGGGACG
TGGGGCACAGCTGAATTTTCCTGAAATGGAAGATAGCCTCCCCCGGCCAGCCAGTTCTAGAGCGGAGGACGTGCAAGCGGCAGCACGGGAGGCAGCTTTG
CTGTTTAGTGGACCAGTAAAATGCTCGGATATTGTAAGCTGTGGCTCTATTACTAGTGATGGTGGTTTTGGTCCTGTTAGAGTGGGGTTGTCACCGAGCC
AAATTCAAGCTATTAACGAAGCACCACTGGACTCGCCAAAAATGTGGACGGAGTACTTGGCTGAGTCTCTTTTGACGGGAGAGCCGATGGCTATGGAGAA
CGAAATTGGTGTCGGATATAGTGAATGGGAGGAAATTCAACAAGAATCCATTTGGGGTTACTACTAA
AA sequence
>Potri.003G054100.1 pacid=42784801 polypeptide=Potri.003G054100.1.p locus=Potri.003G054100 ID=Potri.003G054100.1.v4.1 annot-version=v4.1
MEGRSRDAHADQISTPRYRGIRQRKWGTWVSEIREPGQKTRIWLGSYEKPEMAAVAYDVAALHLRGRGAQLNFPEMEDSLPRPASSRAEDVQAAAREAAL
LFSGPVKCSDIVSCGSITSDGGFGPVRVGLSPSQIQAINEAPLDSPKMWTEYLAESLLTGEPMAMENEIGVGYSEWEEIQQESIWGYY

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G71450 AP2_ERF Integrase-type DNA-binding sup... Potri.003G054100 0 1
AT2G44840 AP2_ERF ATERF13, EREBP ethylene-responsive element bi... Potri.014G047000 4.89 0.9660 ERF7
AT2G44840 AP2_ERF ATERF13, EREBP ethylene-responsive element bi... Potri.014G046600 6.48 0.9583
AT3G47570 Leucine-rich repeat protein ki... Potri.011G102800 7.34 0.9489
AT5G67080 MAPKKK19 mitogen-activated protein kina... Potri.007G044800 7.74 0.9412
AT1G58290 AtHEMA1, HEMA1 Arabidopsis thaliana hemA 1, G... Potri.009G080600 9.21 0.9522
AT1G80840 WRKY ATWRKY40, WRKY4... WRKY DNA-binding protein 40 (.... Potri.003G182200 9.59 0.9548 WRKY40.2
AT4G39830 Cupredoxin superfamily protein... Potri.007G088358 9.89 0.9486
AT5G09360 LAC14 laccase 14 (.1) Potri.019G088700 12.40 0.9380
AT4G39830 Cupredoxin superfamily protein... Potri.007G088290 12.40 0.9414
AT5G67080 MAPKKK19 mitogen-activated protein kina... Potri.005G139300 13.56 0.9305

Potri.003G054100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.