Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G14080 234 / 3e-81 Small nuclear ribonucleoprotein family protein (.1.2) AT1G19120 218 / 1e-74 Small nuclear ribonucleoprotein family protein (.1) AT1G65700 61 / 3e-13 Small nuclear ribonucleoprotein family protein (.1.2.3) AT3G11500 51 / 1e-09 Small nuclear ribonucleoprotein family protein (.1) AT2G23930 50 / 6e-09 SNRNP-G probable small nuclear ribonucleoprotein G (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G166600 [exp] 254 / 6e-89 AT3G14080 233 / 9e-81 Small nuclear ribonucleoprotein family protein (.1.2) Potri.001G278000 [exp] 62 / 9e-14 AT1G65700 146 / 3e-47 Small nuclear ribonucleoprotein family protein (.1.2.3) Potri.006G211100 [exp] 51 / 2e-09 AT3G11500 153 / 2e-50 Small nuclear ribonucleoprotein family protein (.1) Potri.016G078100 [exp] 51 / 2e-09 AT3G11500 152 / 5e-50 Small nuclear ribonucleoprotein family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008124 [exp] 249 / 6e-87 AT3G14080 236 / 3e-82 Small nuclear ribonucleoprotein family protein (.1.2) Lus10013161 [exp] 190 / 5e-64 AT3G14080 180 / 3e-60 Small nuclear ribonucleoprotein family protein (.1.2) Lus10021342 [exp] 50 / 4e-09 AT3G11500 152 / 3e-50 Small nuclear ribonucleoprotein family protein (.1) Lus10017019 [exp] 49 / 1e-08 AT3G11500 150 / 2e-49 Small nuclear ribonucleoprotein family protein (.1) Lus10042884 [exp] 47 / 1e-07 AT1G65700 158 / 7e-52 Small nuclear ribonucleoprotein family protein (.1.2.3) Lus10028183 [exp] 40 / 3e-05 AT1G65700 155 / 8e-51 Small nuclear ribonucleoprotein family protein (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0527 [poplar] [flax] Sm-like PF01423 [poplar] [flax] LSM LSM domain
Representative CDS sequence Show only first row Show all	>Potri.003G068400.1 pacid=42787117 polypeptide=Potri.003G068400.1.p locus=Potri.003G068400 ID=Potri.003G068400.1.v4.1 annot-version=v4.1 ATGTCTTGGGCAGGCCCGGAAGATATCTACCTCTCTACTTCTCTTGCTAGCTATCTTGATAAGAAGCTTCTTGTGCTTCTACGAGATGGCCGAAAGCTCA TGGGAATACTTCGTTCTTTTGACCAATTTGCCAATGCTGTTCTTGAAGGTGCATGTGAAAGAGCTATTGTTGGCGACCTTTATTGCGACATCCACTTGGG TCTATATGTAATTCGTGGCGAGAATGTTGTCTTAATTGGGGAGCTGGATTTGGAGAGGGAGGAACTTCCACCACATATGACTCGTGTTTCAGAAGCAGAA ATTAAAAGGGCACAGAAAGCAGAAAGGGAGGCTACAGATCTCAAAGGTACAATGAGGAAAAGAATGGAGTTCCTTGATTTGGATTAG
AA sequence Show only first row Show all	>Potri.003G068400.1 pacid=42787117 polypeptide=Potri.003G068400.1.p locus=Potri.003G068400 ID=Potri.003G068400.1.v4.1 annot-version=v4.1 MSWAGPEDIYLSTSLASYLDKKLLVLLRDGRKLMGILRSFDQFANAVLEGACERAIVGDLYCDIHLGLYVIRGENVVLIGELDLEREELPPHMTRVSEAE IKRAQKAEREATDLKGTMRKRMEFLDLD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G14080			Small nuclear ribonucleoprotei...		Potri.003G068400 [exp]	0	1
AT4G35510			unknown protein		Potri.005G102000 [exp]	9.79	0.7064
AT1G50370		AtFYPP1	flower- specific, phytochrome-...		Potri.010G254500 [exp]	11.31	0.7272	ATFYPP3.1
AT4G23630		RTNLB1, BTI1	Reticulan like protein B1, VIR...		Potri.001G097700 [exp]	17.57	0.7034
AT4G17650			Polyketide cyclase / dehydrase...		Potri.002G126000 [exp]	18.89	0.6747
AT1G53570		MAPKKK3, MAP3KA	MAP KINASE KINASE KINASE 3, mi...		Potri.005G062500 [exp]	19.62	0.6684	Pt-MAP3.1
AT4G27000		ATRBP45C	RNA-binding (RRM/RBD/RNP motif...		Potri.001G423400 [exp]	21.90	0.6567
AT5G10010			unknown protein		Potri.005G083700 [exp]	22.97	0.6528
AT5G05987		PRA1.A2	prenylated RAB acceptor 1.A2 (...		Potri.010G198000 [exp]	23.23	0.6519
AT5G06140		ATSNX1	ARABIDOPSIS THALIANA SORTING N...		Potri.016G076400 [exp]	26.11	0.6509
AT1G30880			unknown protein		Potri.003G155400 [exp]	27.42	0.6747

Compare expression of checked genes

Potri.003G068400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.