Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G11410 178 / 2e-55 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT4G23430 171 / 9e-53 AtTic32-IVa translocon at the inner envelope membrane of chloroplasts 32-IVa, NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3) AT4G23420 169 / 5e-52 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3) AT2G37540 139 / 1e-40 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT5G02540 136 / 4e-39 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT4G24050 114 / 7e-31 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT5G50130 107 / 3e-28 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2) AT1G64590 103 / 9e-27 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT4G27440 52 / 3e-08 PORB protochlorophyllide oxidoreductase B (.1.2) AT5G54190 52 / 4e-08 PORA protochlorophyllide oxidoreductase A (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G103000 [exp] 259 / 3e-87 AT4G11410 446 / 4e-159 NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.003G128700 [exp] 194 / 1e-61 AT4G11410 497 / 4e-179 NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.012G143600 [exp] 176 / 2e-54 AT4G23430 401 / 2e-140 translocon at the inner envelope membrane of chloroplasts 32-IVa, NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3) Potri.003G128800 [exp] 169 / 6e-52 AT4G23420 442 / 5e-157 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3) Potri.015G146600 [exp] 168 / 1e-51 AT4G23420 444 / 6e-158 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3) Potri.012G143800 [exp] 146 / 3e-43 AT4G23420 427 / 3e-151 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3) Potri.006G083900 [exp] 139 / 4e-40 AT5G02540 452 / 3e-161 NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.015G081102 [exp] 128 / 5e-36 AT5G50130 454 / 2e-161 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2) Potri.T124508 [exp] 128 / 5e-36 AT5G50130 454 / 2e-161 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035481 [exp] 192 / 4e-61 AT4G23430 479 / 6e-172 translocon at the inner envelope membrane of chloroplasts 32-IVa, NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3) Lus10031101 [exp] 186 / 1e-58 AT4G23430 478 / 1e-171 translocon at the inner envelope membrane of chloroplasts 32-IVa, NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3) Lus10024649 [exp] 185 / 4e-58 AT4G11410 446 / 5e-159 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10024647 [exp] 183 / 2e-57 AT4G11410 461 / 1e-164 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10032281 [exp] 182 / 3e-57 AT4G11410 447 / 2e-159 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10024685 [exp] 179 / 3e-55 AT4G23430 431 / 4e-152 translocon at the inner envelope membrane of chloroplasts 32-IVa, NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3) Lus10028781 [exp] 176 / 7e-55 AT4G11410 470 / 3e-168 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10032282 [exp] 176 / 8e-55 AT4G23430 459 / 8e-164 translocon at the inner envelope membrane of chloroplasts 32-IVa, NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3) Lus10024648 [exp] 176 / 1e-54 AT4G23430 447 / 2e-159 translocon at the inner envelope membrane of chloroplasts 32-IVa, NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3) Lus10014975 [exp] 174 / 1e-53 AT4G23430 442 / 8e-157 translocon at the inner envelope membrane of chloroplasts 32-IVa, NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0063 [poplar] [flax] NADP_Rossmann PF00106 [poplar] [flax] adh_short short chain dehydrogenase
Representative CDS sequence Show only first row Show all	>Potri.003G128901.1 pacid=42784514 polypeptide=Potri.003G128901.1.p locus=Potri.003G128901 ID=Potri.003G128901.1.v4.1 annot-version=v4.1 ATGAAAGAATTATCTGTGGTTTTGAATCAAATCTTAATTTCCAGGAGCATCAAGTGGTATTGGTGCGGAGACAACGCGTGTCCTTGCAATGCGTGGTGTC CATGTAGTTATGGCAGTGAGGAATCTGGTAGGAACGTCAAAGAAGCAATACTCAAGGAAATCCCCACTGATCAGATTGATGTTATGGAGTTAGATCTGAG ATCAATGGCATCAGTTAGGAAGTTTGCATCAGAATATACTACCTTGGGTCTTCCTTTGAACATCCTCATTAATAATGCAGGGGTTCTGTCATCTCCTTCC AAGCTTTCTCAAGATAACATTGAAATGTTATTTGCAACCAACCATATAGGTCACCGTATTGTGAGTCGGGAAGGAATTTGTTTCGATAAAATCTATGACG AGGCAAGTTGGTTTTCTTATGGGCAATCTAAGCTTGCTAACATATTGCACGCCAATGAGCTTGCAAGGCGCCTGAAGCAAGAAGGGGAAGAGATAACTAT TAATTCACTACATCCTGGAGCAATCCATGCCAATCTTCTGCGTCACCAAGGTTTTGTTAATGGAGTAAATTAA
AA sequence Show only first row Show all	>Potri.003G128901.1 pacid=42784514 polypeptide=Potri.003G128901.1.p locus=Potri.003G128901 ID=Potri.003G128901.1.v4.1 annot-version=v4.1 MKELSVVLNQILISRSIKWYWCGDNACPCNAWCPCSYGSEESGRNVKEAILKEIPTDQIDVMELDLRSMASVRKFASEYTTLGLPLNILINNAGVLSSPS KLSQDNIEMLFATNHIGHRIVSREGICFDKIYDEASWFSYGQSKLANILHANELARRLKQEGEEITINSLHPGAIHANLLRHQGFVNGVN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G11410			NAD(P)-binding Rossmann-fold s...		Potri.003G128901 [exp]	0	1
AT5G39130			RmlC-like cupins superfamily p...		Potri.013G063101 [exp]	12.32	0.8897
AT5G39130			RmlC-like cupins superfamily p...		Potri.013G063051 [exp]	12.44	0.8892
AT5G39130			RmlC-like cupins superfamily p...		Potri.013G062950 [exp]	13.41	0.8888
AT4G01500	B3	NGA4	NGATHA4, AP2/B3-like transcrip...		Potri.014G067900 [exp]	13.56	0.6526
AT5G39130			RmlC-like cupins superfamily p...		Potri.013G063200 [exp]	14.49	0.8875
AT5G39130			RmlC-like cupins superfamily p...		Potri.013G063100 [exp]	18.97	0.8767
AT5G39130			RmlC-like cupins superfamily p...		Potri.013G063001 [exp]	20.00	0.8749
					Potri.008G142940 [exp]	20.71	0.7848
AT5G43580		UPI	UNUSUAL SERINE PROTEASE INHIBI...		Potri.005G221000 [exp]	26.83	0.8296
AT5G39130			RmlC-like cupins superfamily p...		Potri.013G064100 [exp]	27.74	0.8585

Compare expression of checked genes

Potri.003G128901 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.