Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G07475 179 / 2e-57 Cupredoxin superfamily protein (.1) AT2G32300 117 / 2e-32 UCC1 uclacyanin 1 (.1) AT3G27200 96 / 2e-25 Cupredoxin superfamily protein (.1) AT3G60270 96 / 5e-25 Cupredoxin superfamily protein (.1) AT5G26330 95 / 1e-24 Cupredoxin superfamily protein (.1) AT1G72230 93 / 7e-24 Cupredoxin superfamily protein (.1) AT2G26720 89 / 2e-22 Cupredoxin superfamily protein (.1) AT3G60280 88 / 2e-21 UCC3 uclacyanin 3 (.1) AT2G31050 87 / 2e-21 Cupredoxin superfamily protein (.1) AT3G17675 83 / 9e-21 Cupredoxin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G080700 [exp] 288 / 8e-101 AT5G07475 164 / 1e-51 Cupredoxin superfamily protein (.1) Potri.007G120200 [exp] 110 / 6e-30 AT2G32300 118 / 3e-32 uclacyanin 1 (.1) Potri.014G049600 [exp] 104 / 3e-28 AT3G60270 111 / 8e-31 Cupredoxin superfamily protein (.1) Potri.002G101300 [exp] 102 / 1e-27 AT1G72230 131 / 6e-39 Cupredoxin superfamily protein (.1) Potri.002G101200 [exp] 102 / 7e-27 AT1G72230 129 / 2e-37 Cupredoxin superfamily protein (.1) Potri.003G047300 [exp] 97 / 4e-25 AT5G26330 121 / 2e-34 Cupredoxin superfamily protein (.1) Potri.001G332200 [exp] 92 / 7e-24 AT3G27200 171 / 5e-55 Cupredoxin superfamily protein (.1) Potri.006G259101 [exp] 89 / 1e-22 AT5G26330 142 / 2e-43 Cupredoxin superfamily protein (.1) Potri.013G030450 [exp] 87 / 6e-22 AT3G17675 106 / 2e-30 Cupredoxin superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012085 [exp] 172 / 4e-55 AT5G07475 142 / 4e-43 Cupredoxin superfamily protein (.1) Lus10027143 [exp] 123 / 4e-35 AT2G32300 137 / 9e-40 uclacyanin 1 (.1) Lus10007401 [exp] 115 / 3e-30 AT1G51690 460 / 7e-159 protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform (.1.2.3) Lus10008720 [exp] 108 / 7e-30 AT1G72230 140 / 2e-42 Cupredoxin superfamily protein (.1) Lus10020944 [exp] 105 / 2e-28 AT1G72230 141 / 1e-42 Cupredoxin superfamily protein (.1) Lus10022350 [exp] 92 / 2e-23 AT3G27200 169 / 7e-54 Cupredoxin superfamily protein (.1) Lus10027043 [exp] 91 / 1e-22 AT1G72230 112 / 4e-31 Cupredoxin superfamily protein (.1) Lus10012165 [exp] 89 / 2e-22 AT5G07475 89 / 1e-22 Cupredoxin superfamily protein (.1) Lus10010533 [exp] 88 / 6e-22 AT5G26330 174 / 1e-55 Cupredoxin superfamily protein (.1) Lus10041570 [exp] 88 / 7e-22 AT3G27200 167 / 2e-53 Cupredoxin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0026 [poplar] [flax] CU_oxidase PF02298 [poplar] [flax] Cu_bind_like Plastocyanin-like domain
Representative CDS sequence Show only first row Show all	>Potri.003G150300.1 pacid=42786804 polypeptide=Potri.003G150300.1.p locus=Potri.003G150300 ID=Potri.003G150300.1.v4.1 annot-version=v4.1 ATGGGTAAGCTGGTTTTGGTCTTTTCTCTTGTTGTTCTTGGCCTAGCAGTGACATGCAAGGCAGCAACTTACATGGTAGGTGATAATTCAGGCTGGGACA TAAGCACTGACATTGATACGTGGGCACAGGACAAGACATTTGCTGTTGGGGACGTTCTAATGTTTCAATACTCTTCATCCCACAGTGTTGATGAGGTAAA GAAAGAAGATTTCGACAGCTGCAACACGACCAATGTTCTAAGAACATTCACTACTGGGAACACAACTGTGTCATTGACAAACCCTGGAACGAGGTACTTC GTTTGTGGCAACAAGTTACATTGTCTAGGAGGAATGAAGCTTCAGGTAAATGTAGCAAGCAATCAAGCAGATTCACCGACCGGCGCGCCACAAACACATC CAGGGGGTAATATTTCACAACCTTCTTCTAAGAGCAACAACCCGGCCTCTGTTATTCCAACTTCAGCAGGGTCTGTCTATGGCGGAAGGGATTCTATTGT AATGGCTTTTCTTGGTTTTATGGCTACTTTGTCATGGGCAGTGCAAGTTTGA
AA sequence Show only first row Show all	>Potri.003G150300.1 pacid=42786804 polypeptide=Potri.003G150300.1.p locus=Potri.003G150300 ID=Potri.003G150300.1.v4.1 annot-version=v4.1 MGKLVLVFSLVVLGLAVTCKAATYMVGDNSGWDISTDIDTWAQDKTFAVGDVLMFQYSSSHSVDEVKKEDFDSCNTTNVLRTFTTGNTTVSLTNPGTRYF VCGNKLHCLGGMKLQVNVASNQADSPTGAPQTHPGGNISQPSSKSNNPASVIPTSAGSVYGGRDSIVMAFLGFMATLSWAVQV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G07475			Cupredoxin superfamily protein...		Potri.003G150300 [exp]	0	1
					Potri.017G047100 [exp]	1.41	0.9883
AT2G48140		EDA4	embryo sac development arrest ...		Potri.005G212000 [exp]	1.73	0.9820
					Potri.017G047200 [exp]	2.00	0.9829
AT2G15490		UGT73B4	UDP-glycosyltransferase 73B4 (...		Potri.001G302400 [exp]	3.16	0.9715
AT3G11430		ATGPAT5, GPAT5	glycerol-3-phosphate acyltrans...		Potri.010G201200 [exp]	3.46	0.9776
AT4G35160			O-methyltransferase family pro...		Potri.011G059500 [exp]	3.87	0.9780	Pt-OOMT2.14,FOMT7
AT1G34670	MYB	ATMYB93	myb domain protein 93 (.1)		Potri.005G164900 [exp]	4.89	0.9706
					Potri.019G082600 [exp]	5.29	0.9797
AT4G22810	AT-hook		Predicted AT-hook DNA-binding ...		Potri.003G116900 [exp]	6.48	0.9750
					Potri.017G046800 [exp]	7.48	0.9742

Compare expression of checked genes

Potri.003G150300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.