Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G46410 71 / 7e-18 MYB CPC CAPRICE, Homeodomain-like superfamily protein (.1) AT1G01380 70 / 2e-17 MYB ETC1 ENHANCER OF TRY AND CPC 1, Homeodomain-like superfamily protein (.1) AT4G01060 65 / 1e-15 MYB CPL3, ETC3 ENHANCER OF TRY AND CPC 3, CAPRICE-like MYB3 (.1.2.3) AT5G53200 63 / 1e-14 MYB TRY TRIPTYCHON, Homeodomain-like superfamily protein (.1) AT2G30420 61 / 8e-14 MYB ETC2 ENHANCER OF TRY AND CPC 2, Homeodomain-like superfamily protein (.1) AT5G35550 61 / 1e-12 MYB ATTT2, TT2, AtMYB123 TRANSPARENT TESTA 2, MYB DOMAIN PROTEIN 123, Duplicated homeodomain-like superfamily protein (.1) AT3G13540 60 / 2e-12 MYB ATMYB5, ATM2 myb domain protein 5 (.1) AT1G71030 59 / 3e-12 MYB MYBL2, ATMYBL2 ARABIDOPSIS MYB-LIKE 2, MYB-like 2 (.1) AT2G30432 57 / 3e-12 MYB TCL1 TRICHOMELESS1, Homeodomain-like superfamily protein (.1) AT2G30424 57 / 5e-12 MYB TCL2 TRICHOMELESS 2, Homeodomain-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G122800 [exp] 90 / 2e-25 AT2G46410 69 / 3e-17 CAPRICE, Homeodomain-like superfamily protein (.1) Potri.011G026300 [exp] 89 / 2e-25 AT1G01380 68 / 9e-17 ENHANCER OF TRY AND CPC 1, Homeodomain-like superfamily protein (.1) Potri.017G037000 [exp] 89 / 3e-25 AT2G46410 69 / 4e-17 CAPRICE, Homeodomain-like superfamily protein (.1) Potri.004G021300 [exp] 88 / 8e-25 AT1G01380 67 / 1e-16 ENHANCER OF TRY AND CPC 1, Homeodomain-like superfamily protein (.1) Potri.012G031200 [exp] 71 / 3e-17 AT5G53200 102 / 6e-29 TRIPTYCHON, Homeodomain-like superfamily protein (.1) Potri.002G168900 [exp] 69 / 8e-17 AT5G53200 122 / 2e-37 TRIPTYCHON, Homeodomain-like superfamily protein (.1) Potri.015G022000 [exp] 68 / 2e-16 AT5G53200 104 / 2e-30 TRIPTYCHON, Homeodomain-like superfamily protein (.1) Potri.014G096300 [exp] 66 / 8e-16 AT2G46410 114 / 1e-34 CAPRICE, Homeodomain-like superfamily protein (.1) Potri.015G041100 [exp] 66 / 8e-15 AT1G22640 212 / 2e-69 ARABIDOPSIS THALIANA MYB DOMAIN PROTEIN 3, myb domain protein 3 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007643 [exp] 74 / 7e-19 AT2G46410 65 / 3e-15 CAPRICE, Homeodomain-like superfamily protein (.1) Lus10018414 [exp] 78 / 2e-18 AT4G05120 548 / 0.0 FUDR RESISTANT 1, EQUILIBRATIVE NUCLEOSIDE TRANSPORTER 3, Major facilitator superfamily protein (.1) Lus10018366 [exp] 72 / 5e-18 AT2G46410 67 / 2e-15 CAPRICE, Homeodomain-like superfamily protein (.1) Lus10038822 [exp] 67 / 2e-16 AT5G53200 96 / 1e-27 TRIPTYCHON, Homeodomain-like superfamily protein (.1) Lus10014933 [exp] 66 / 7e-16 AT2G46410 96 / 1e-27 CAPRICE, Homeodomain-like superfamily protein (.1) Lus10001043 [exp] 66 / 6e-15 AT1G22640 119 / 1e-33 ARABIDOPSIS THALIANA MYB DOMAIN PROTEIN 3, myb domain protein 3 (.1) Lus10005949 [exp] 62 / 5e-14 AT4G01060 91 / 2e-25 ENHANCER OF TRY AND CPC 3, CAPRICE-like MYB3 (.1.2.3) Lus10028513 [exp] 63 / 3e-13 AT1G66370 205 / 3e-65 myb domain protein 113 (.1) Lus10009130 [exp] 63 / 3e-13 AT1G66370 202 / 3e-64 myb domain protein 113 (.1) Lus10038092 [exp] 61 / 9e-13 AT5G52600 185 / 1e-58 myb domain protein 82 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0123 [poplar] [flax] HTH PF00249 [poplar] [flax] Myb_DNA-binding Myb-like DNA-binding domain
Representative CDS sequence Show only first row Show all	>Potri.004G015100.1 pacid=42795735 polypeptide=Potri.004G015100.1.p locus=Potri.004G015100 ID=Potri.004G015100.1.v4.1 annot-version=v4.1 ATGGCTTGCTCGGGTCACACCTCAGATAACACAAATCAAGATACCAAGGCTGCAAAGAGTAATCAAGACTCCAACCTGCAGGATTTCTCTGAAGATGAAG AGAATCTCATTGCTAGAATGTTTGGCTTGGTTGGGAAGAGATGGTCACTAATTGCTGGGAGAATACCAGGAAGAACAGCAGAGGAGATTGAGAAGTATTG GACTTCAAAGTATAGATCATCAAAGGAAAGATGA
AA sequence Show only first row Show all	>Potri.004G015100.1 pacid=42795735 polypeptide=Potri.004G015100.1.p locus=Potri.004G015100 ID=Potri.004G015100.1.v4.1 annot-version=v4.1 MACSGHTSDNTNQDTKAAKSNQDSNLQDFSEDEENLIARMFGLVGKRWSLIAGRIPGRTAEEIEKYWTSKYRSSKER

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G46410	MYB	CPC	CAPRICE, Homeodomain-like supe...		Potri.004G015100 [exp]	0	1
AT3G49810			ARM repeat superfamily protein...		Potri.014G014300 [exp]	1.41	0.9417
AT5G57130			Clp amino terminal domain-cont...		Potri.018G140900 [exp]	2.23	0.9338
AT1G73850			Protein of unknown function (D...		Potri.012G056400 [exp]	3.74	0.9409
AT1G74720		QKY	QUIRKY, C2 calcium/lipid-bindi...		Potri.006G098700 [exp]	4.24	0.9225
AT5G16560	GARP	KAN1, KAN	KANADI 1, KANADI, Homeodomain-...		Potri.015G031600 [exp]	5.19	0.9403
AT4G32980	HD	ATH1	homeobox gene 1 (.1)		Potri.006G230700 [exp]	5.29	0.9146
AT1G06490		CalS7, ATGSL7, ...	callose synthase 7, Arabidopsi...		Potri.002G058700 [exp]	6.63	0.9401	ATGSL11.2
AT2G24520		AHA5	H\(+\)-ATPase 5, H\(+\)-ATPase...		Potri.018G006000 [exp]	9.48	0.9308	Pt-VHA1.1
AT2G19480		NFA2, NFA02, NA...	NUCLEOSOME/CHROMATIN ASSEMBLY ...		Potri.003G036200 [exp]	10.90	0.9239
AT2G14830			Regulator of Vps4 activity in ...		Potri.004G038600 [exp]	11.31	0.9025

Compare expression of checked genes

Potri.004G015100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.