Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G46410 67 / 2e-16 MYB CPC CAPRICE, Homeodomain-like superfamily protein (.1) AT1G01380 67 / 2e-16 MYB ETC1 ENHANCER OF TRY AND CPC 1, Homeodomain-like superfamily protein (.1) AT5G53200 66 / 1e-15 MYB TRY TRIPTYCHON, Homeodomain-like superfamily protein (.1) AT4G01060 62 / 2e-14 MYB CPL3, ETC3 ENHANCER OF TRY AND CPC 3, CAPRICE-like MYB3 (.1.2.3) AT5G14750 64 / 4e-14 MYB WER1, WER, AtMYB66 WEREWOLF 1, WEREWOLF, myb domain protein 66 (.1) AT5G35550 64 / 4e-14 MYB ATTT2, TT2, AtMYB123 TRANSPARENT TESTA 2, MYB DOMAIN PROTEIN 123, Duplicated homeodomain-like superfamily protein (.1) AT4G09460 64 / 6e-14 MYB ATMYB6, ATMYB8 myb domain protein 6 (.1) AT3G13540 64 / 8e-14 MYB ATMYB5, ATM2 myb domain protein 5 (.1) AT5G40330 63 / 1e-13 MYB ATMYBRTF, ATMYB23 myb domain protein 23 (.1) AT5G52600 62 / 1e-13 MYB AtMYB82 myb domain protein 82 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G026300 [exp] 137 / 3e-44 AT1G01380 68 / 9e-17 ENHANCER OF TRY AND CPC 1, Homeodomain-like superfamily protein (.1) Potri.017G037000 [exp] 105 / 1e-31 AT2G46410 69 / 4e-17 CAPRICE, Homeodomain-like superfamily protein (.1) Potri.007G122800 [exp] 100 / 6e-30 AT2G46410 69 / 3e-17 CAPRICE, Homeodomain-like superfamily protein (.1) Potri.004G015100 [exp] 88 / 6e-25 AT2G46410 71 / 1e-17 CAPRICE, Homeodomain-like superfamily protein (.1) Potri.002G168900 [exp] 69 / 7e-17 AT5G53200 122 / 2e-37 TRIPTYCHON, Homeodomain-like superfamily protein (.1) Potri.014G096300 [exp] 67 / 2e-16 AT2G46410 114 / 1e-34 CAPRICE, Homeodomain-like superfamily protein (.1) Potri.018G005300 [exp] 70 / 1e-15 AT1G22640 186 / 9e-57 ARABIDOPSIS THALIANA MYB DOMAIN PROTEIN 3, myb domain protein 3 (.1) Potri.018G049600 [exp] 68 / 2e-15 AT2G16720 192 / 4e-60 ARABIDOPSIS THALIANA MYB DOMAIN PROTEIN 7, myb domain protein 7 (.1) Potri.012G031200 [exp] 66 / 2e-15 AT5G53200 102 / 6e-29 TRIPTYCHON, Homeodomain-like superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018366 [exp] 88 / 3e-24 AT2G46410 67 / 2e-15 CAPRICE, Homeodomain-like superfamily protein (.1) Lus10007643 [exp] 85 / 2e-23 AT2G46410 65 / 3e-15 CAPRICE, Homeodomain-like superfamily protein (.1) Lus10018414 [exp] 88 / 6e-22 AT4G05120 548 / 0.0 FUDR RESISTANT 1, EQUILIBRATIVE NUCLEOSIDE TRANSPORTER 3, Major facilitator superfamily protein (.1) Lus10001043 [exp] 70 / 9e-17 AT1G22640 119 / 1e-33 ARABIDOPSIS THALIANA MYB DOMAIN PROTEIN 3, myb domain protein 3 (.1) Lus10005949 [exp] 67 / 3e-16 AT4G01060 91 / 2e-25 ENHANCER OF TRY AND CPC 3, CAPRICE-like MYB3 (.1.2.3) Lus10028513 [exp] 68 / 5e-15 AT1G66370 205 / 3e-65 myb domain protein 113 (.1) Lus10038822 [exp] 64 / 5e-15 AT5G53200 96 / 1e-27 TRIPTYCHON, Homeodomain-like superfamily protein (.1) Lus10039173 [exp] 67 / 7e-15 AT3G13540 244 / 3e-81 myb domain protein 5 (.1) Lus10033438 [exp] 67 / 1e-14 AT1G22640 194 / 2e-61 ARABIDOPSIS THALIANA MYB DOMAIN PROTEIN 3, myb domain protein 3 (.1) Lus10014933 [exp] 63 / 1e-14 AT2G46410 96 / 1e-27 CAPRICE, Homeodomain-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0123 [poplar] [flax] HTH PF00249 [poplar] [flax] Myb_DNA-binding Myb-like DNA-binding domain
Representative CDS sequence Show only first row Show all	>Potri.004G021300.1 pacid=42796429 polypeptide=Potri.004G021300.1.p locus=Potri.004G021300 ID=Potri.004G021300.1.v4.1 annot-version=v4.1 ATGGCTGACACTGAACATTCTTCTTCTGATGAAACTTCTGTGGATTCTAGAGAGGAAACAAGTCAGGAATCAAAGCTTGAATTCTCTGAGGATGAGGAGA CGCTTATAATTAGGATGTTTAATCTAGTTGGAGAGAGGTGGTCTCTAATTGCTGGAAGGATTCCAGGAAGAACAGCTGAGGAAATAGAGAAGTATTGGAA CACTAGATGCTCTACGAGTGAATGA
AA sequence Show only first row Show all	>Potri.004G021300.1 pacid=42796429 polypeptide=Potri.004G021300.1.p locus=Potri.004G021300 ID=Potri.004G021300.1.v4.1 annot-version=v4.1 MADTEHSSSDETSVDSREETSQESKLEFSEDEETLIIRMFNLVGERWSLIAGRIPGRTAEEIEKYWNTRCSTSE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G01380	MYB	ETC1	ENHANCER OF TRY AND CPC 1, Hom...		Potri.004G021300 [exp]	0	1
AT3G02875		ILR1	IAA-LEUCINE RESISTANT 1, Pepti...		Potri.006G207400 [exp]	16.30	0.6849	ILL1,Pt-ILR1.2
AT3G03190		ATGSTF6, ATGSTF...	ARABIDOPSIS GLUTATHIONE-S-TRAN...		Potri.002G015100 [exp]	17.20	0.7838
AT5G53880			unknown protein		Potri.011G117001 [exp]	21.56	0.7336
AT1G27340			Galactose oxidase/kelch repeat...		Potri.003G062000 [exp]	28.98	0.7073
AT4G25570		ACYB-2	Cytochrome b561/ferric reducta...		Potri.015G143700 [exp]	31.41	0.7008
AT5G66900			Disease resistance protein (CC...		Potri.007G039300 [exp]	45.95	0.6992
AT5G06300		LOG7	LONELY GUY 7, Putative lysine ...		Potri.005G237600 [exp]	47.72	0.7116
AT1G69040		ACR4	ACT domain repeat 4 (.1.2)		Potri.010G138600 [exp]	49.08	0.6656
AT5G08350			GRAM domain-containing protein...		Potri.007G075200 [exp]	50.47	0.6953
AT5G21930		ATHMA8, HMA8, P...	ARABIDOPSIS HEAVY METAL ATPASE...		Potri.018G047800 [exp]	51.67	0.6928

Compare expression of checked genes

Potri.004G021300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.