Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G15350 149 / 4e-46 AtENODL17 early nodulin-like protein 17 (.1) AT4G12880 130 / 3e-39 AtENODL19 early nodulin-like protein 19 (.1.2) AT3G01070 118 / 3e-34 AtENODL16 early nodulin-like protein 16 (.1) AT2G27035 89 / 1e-22 AtENODL20 early nodulin-like protein 20 (.1) AT2G32300 64 / 9e-13 UCC1 uclacyanin 1 (.1) AT3G60270 62 / 2e-12 Cupredoxin superfamily protein (.1) AT5G53870 60 / 6e-11 AtENODL1 early nodulin-like protein 1 (.1) AT5G26330 59 / 6e-11 Cupredoxin superfamily protein (.1) AT3G27200 58 / 1e-10 Cupredoxin superfamily protein (.1) AT3G20570 58 / 1e-10 AtENODL9 early nodulin-like protein 9 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G088600 [exp] 246 / 2e-84 AT5G15350 194 / 5e-64 early nodulin-like protein 17 (.1) Potri.017G088500 [exp] 97 / 8e-26 AT2G27035 122 / 7e-36 early nodulin-like protein 20 (.1) Potri.001G219800 [exp] 95 / 2e-24 AT2G27035 130 / 1e-38 early nodulin-like protein 20 (.1) Potri.001G219900 [exp] 91 / 2e-23 AT2G27035 136 / 2e-41 early nodulin-like protein 20 (.1) Potri.003G183300 [exp] 90 / 1e-22 AT5G15350 123 / 1e-35 early nodulin-like protein 17 (.1) Potri.001G043600 [exp] 86 / 2e-21 AT5G15350 121 / 2e-35 early nodulin-like protein 17 (.1) Potri.003G047300 [exp] 69 / 8e-15 AT5G26330 121 / 2e-34 Cupredoxin superfamily protein (.1) Potri.003G150300 [exp] 68 / 2e-14 AT5G07475 178 / 2e-57 Cupredoxin superfamily protein (.1) Potri.002G161300 [exp] 67 / 4e-14 AT5G26330 146 / 5e-45 Cupredoxin superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030690 [exp] 197 / 9e-65 AT5G15350 190 / 4e-62 early nodulin-like protein 17 (.1) Lus10005231 [exp] 197 / 1e-64 AT5G15350 192 / 8e-63 early nodulin-like protein 17 (.1) Lus10026749 [exp] 95 / 5e-25 AT2G27035 135 / 7e-41 early nodulin-like protein 20 (.1) Lus10005229 [exp] 94 / 2e-24 AT2G27035 124 / 7e-37 early nodulin-like protein 20 (.1) Lus10026064 [exp] 83 / 5e-20 AT5G15350 113 / 4e-32 early nodulin-like protein 17 (.1) Lus10014356 [exp] 79 / 2e-18 AT5G15350 108 / 2e-30 early nodulin-like protein 17 (.1) Lus10012085 [exp] 74 / 8e-17 AT5G07475 142 / 4e-43 Cupredoxin superfamily protein (.1) Lus10025535 [exp] 77 / 1e-16 AT5G19890 406 / 9e-141 Peroxidase superfamily protein (.1) Lus10025536 [exp] 71 / 2e-15 AT2G27035 148 / 5e-46 early nodulin-like protein 20 (.1) Lus10027143 [exp] 68 / 5e-14 AT2G32300 137 / 9e-40 uclacyanin 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0026 [poplar] [flax] CU_oxidase PF02298 [poplar] [flax] Cu_bind_like Plastocyanin-like domain
Representative CDS sequence Show only first row Show all	>Potri.004G121100.1 pacid=42796610 polypeptide=Potri.004G121100.1.p locus=Potri.004G121100 ID=Potri.004G121100.1.v4.1 annot-version=v4.1 ATGGAGAGAAGTGGGTTTGGTTCATCAATGACGGTGGCAGTGGCAGTGGCAGTGCTTGTTTTTGCCATGATGGTGATGGTACCTGAAGTGTCTGCAACTA GATGGACAGTTGGATCCAACATGGGTTGGACAACTAATGTCAACTACACTATGTGGGCTCAAGACAAGCACTTCTACAATGGTGACTGGCTCTATAGGAA CCAAATGAATGTGTTAGAGGTGAACAAAACAGATTTTGAGTCATGCAACTCTGATCATCCTCTTCACAATTTGACCAGGGGAGCTGGAAGAGATGTGGTT CCATTGAACGTCACTCGCACTTACTATTTCATTAGTGGCAAGGGGTTCTGCTATGGAGGCATGAAGTTAGCTGTCCATGTAGCAAACCCACTTCCCCCTC CCACCGCTGCCCCACTAAACGAGAAGAGTGGCTCGTCAAGTTCCATTCTCAAATGCCAGTATGTTCTATCAACTGTTTTCGCCATTGGTGCACTATGGGA TGCATTTGTCTGGTTCTGGTAG
AA sequence Show only first row Show all	>Potri.004G121100.1 pacid=42796610 polypeptide=Potri.004G121100.1.p locus=Potri.004G121100 ID=Potri.004G121100.1.v4.1 annot-version=v4.1 MERSGFGSSMTVAVAVAVLVFAMMVMVPEVSATRWTVGSNMGWTTNVNYTMWAQDKHFYNGDWLYRNQMNVLEVNKTDFESCNSDHPLHNLTRGAGRDVV PLNVTRTYYFISGKGFCYGGMKLAVHVANPLPPPTAAPLNEKSGSSSSILKCQYVLSTVFAIGALWDAFVWFW

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G15350		AtENODL17	early nodulin-like protein 17 ...		Potri.004G121100 [exp]	0	1
AT1G78922			unknown protein		Potri.007G001650 [exp]	1.00	0.9531
AT3G04830			Protein prenylyltransferase su...		Potri.013G038501 [exp]	1.41	0.9465
AT3G20820			Leucine-rich repeat (LRR) fami...		Potri.001G269800 [exp]	2.00	0.9443
AT4G22190			unknown protein		Potri.006G283300 [exp]	2.44	0.9451
AT5G61840		GUT1, IRX10-L	Exostosin family protein (.1)		Potri.015G107200 [exp]	2.44	0.9365
AT3G18190			TCP-1/cpn60 chaperonin family ...		Potri.012G051300 [exp]	3.16	0.9418
AT1G05370			Sec14p-like phosphatidylinosit...		Potri.010G088300 [exp]	6.70	0.9316
AT1G62440		LRX2	leucine-rich repeat/extensin 2...		Potri.006G081200 [exp]	6.92	0.9278
AT5G42920		AtTHO5	THO complex, subunit 5 (.1.2)		Potri.002G125300 [exp]	10.00	0.9315
AT1G20180			Protein of unknown function (D...		Potri.002G018200 [exp]	10.09	0.8836

Compare expression of checked genes

Potri.004G121100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.