Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G34410 130 / 2e-36 AP2_ERF RRTF1 (Redox Responsive Transcription Factor1 ), ERF109 redox responsive transcription factor 1 (.1) AT5G67000 89 / 2e-21 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT2G33710 89 / 2e-21 AP2_ERF Integrase-type DNA-binding superfamily protein (.1.2) AT5G61890 88 / 2e-20 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT5G13330 87 / 2e-20 AP2_ERF RAP2.6L related to AP2 6l (.1) AT5G50080 86 / 7e-20 AP2_ERF ERF110 ethylene response factor 110 (.1) AT5G07310 86 / 1e-19 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT1G43160 84 / 1e-19 AP2_ERF RAP2.6, RAP2.06 related to AP2 6 (.1) AT4G11140 83 / 2e-18 AP2_ERF CRF1 cytokinin response factor 1 (.1) AT2G47520 81 / 2e-18 AP2_ERF AtERF71, ERF71, HRE2 HYPOXIA RESPONSIVE ERF \(ETHYLENE RESPONSE FACTOR\) 2, Arabidopsis thaliana ethylene response factor 71, Integrase-type DNA-binding superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G101900 [exp] 317 / 2e-109 AT4G34410 119 / 2e-32 redox responsive transcription factor 1 (.1) Potri.007G043400 [exp] 93 / 1e-22 AT1G28370 91 / 4e-23 ERF domain protein 11 (.1) Potri.001G067600 [exp] 88 / 1e-20 AT5G13330 130 / 1e-37 related to AP2 6l (.1) Potri.003G162500 [exp] 88 / 1e-20 AT5G13330 142 / 5e-42 related to AP2 6l (.1) Potri.005G195000 [exp] 87 / 2e-19 AT5G50080 108 / 5e-27 ethylene response factor 110 (.1) Potri.012G108500 [exp] 84 / 5e-19 AT5G61890 144 / 3e-42 Integrase-type DNA-binding superfamily protein (.1) Potri.007G076800 [exp] 84 / 2e-18 AT2G33710 104 / 2e-26 Integrase-type DNA-binding superfamily protein (.1.2) Potri.005G087200 [exp] 81 / 1e-17 AT2G33710 87 / 4e-20 Integrase-type DNA-binding superfamily protein (.1.2) Potri.014G126100 [exp] 81 / 1e-17 AT3G16770 122 / 3e-33 RELATED TO AP2 3, ETHYLENE RESPONSE FACTOR 72, ethylene-responsive element binding protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014054 [exp] 171 / 3e-52 AT4G34410 139 / 4e-40 redox responsive transcription factor 1 (.1) Lus10022426 [exp] 85 / 4e-19 AT5G61890 170 / 1e-51 Integrase-type DNA-binding superfamily protein (.1) Lus10003601 [exp] 81 / 8e-18 AT1G72360 144 / 2e-41 HYPOXIA RESPONSIVE ERF \(ETHYLENE RESPONSE FACTOR\) 1, ethylene response factor 73, Integrase-type DNA-binding superfamily protein (.1.2.3) Lus10005805 [exp] 82 / 1e-17 AT5G61890 120 / 4e-32 Integrase-type DNA-binding superfamily protein (.1) Lus10008214 [exp] 81 / 1e-17 AT1G72360 154 / 2e-45 HYPOXIA RESPONSIVE ERF \(ETHYLENE RESPONSE FACTOR\) 1, ethylene response factor 73, Integrase-type DNA-binding superfamily protein (.1.2.3) Lus10033664 [exp] 79 / 1e-17 AT3G15210 119 / 2e-33 RELATED TO AP2 5, ethylene responsive element binding factor 4 (.1) Lus10006796 [exp] 81 / 2e-17 AT5G61890 122 / 8e-33 Integrase-type DNA-binding superfamily protein (.1) Lus10037448 [exp] 80 / 5e-17 AT1G53910 244 / 4e-78 related to AP2 12 (.1.2.3) Lus10039857 [exp] 76 / 3e-16 AT5G44210 138 / 8e-41 ERF DOMAIN PROTEIN- 9, erf domain protein 9 (.1) Lus10013186 [exp] 78 / 4e-16 AT1G53910 254 / 7e-82 related to AP2 12 (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0081 [poplar] [flax] MBD-like PF00847 [poplar] [flax] AP2 AP2 domain
Representative CDS sequence Show only first row Show all	>Potri.004G141200.1 pacid=42793800 polypeptide=Potri.004G141200.1.p locus=Potri.004G141200 ID=Potri.004G141200.1.v4.1 annot-version=v4.1 ATGCAAAGACCCTCGAAGAGATCCAAAATAGGCGAAGCTCCGGCAGCGACCCTCTTTTCACCGCCGGGAATTTCACCGATGAGATTGACCCAAGATCAGG AGTCGGCTGTAATGGTTGCTGCTCTCAGGAACGTAGTTTCTGGCACCAGCTCAACTGATTTTTCAAGGGAGTTCAATAGTCTTAATGTGCCGATCACCAC TTCATATTCACAATTTGGAAGTAGAAGCAGTAACGGGAATGGTTTTTGCATCTCAATATGGCCTCCATCGTCGGATCTTGACATGTGTGCTGTTTGCAAG ATCAAAGGCTGTTTAGGATGCAACTTTTTCCCGCCAAATCAAGAAGATAAAAAAGACGACAAGAAAGGGAAAAGAAAGAGAGTAAAGAAAAATTACAGAG GTGTAAGGCAACGGCCATGGGGGAAATGGGCGGCAGAAATAAGAGATCCGCGGCGGGCTGCAAGGGTTTGGTTAGGGACGTTCAGCACAGCGGAGGAGGC GGCAAGGGCCTATGACAAGGCAGCCATTGATTTTAGAGGGCCAAGAGCTAAGCTCAATTTTCCATTCCCTGACAGTGGTATTTCTAGTTTCGAAGAGAGT AAAGAAAAGCAAGAAGAACAAGCAAAGCAGCAAGAAATAAGCGAGAAGAAAAGTGGATTTGAAGCGGAAATGGGGAAAGAGAGTGAGTTCTGGGATAAGA TCGGGGATGATGAGATACATGAATGGATGATGATGATGTTGGATTTTAGCAATGGGGATTCTTCAGATTCTACTGGCACTGAAAGTGCTGCTACTATCGG GATTTGA
AA sequence Show only first row Show all	>Potri.004G141200.1 pacid=42793800 polypeptide=Potri.004G141200.1.p locus=Potri.004G141200 ID=Potri.004G141200.1.v4.1 annot-version=v4.1 MQRPSKRSKIGEAPAATLFSPPGISPMRLTQDQESAVMVAALRNVVSGTSSTDFSREFNSLNVPITTSYSQFGSRSSNGNGFCISIWPPSSDLDMCAVCK IKGCLGCNFFPPNQEDKKDDKKGKRKRVKKNYRGVRQRPWGKWAAEIRDPRRAARVWLGTFSTAEEAARAYDKAAIDFRGPRAKLNFPFPDSGISSFEES KEKQEEQAKQQEISEKKSGFEAEMGKESEFWDKIGDDEIHEWMMMMLDFSNGDSSDSTGTESAATIGI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G34410	AP2_ERF	RRTF1 (Redox Re...	redox responsive transcription...		Potri.004G141200 [exp]	0	1
AT4G34410	AP2_ERF	RRTF1 (Redox Re...	redox responsive transcription...		Potri.009G101900 [exp]	1.00	0.9759
AT4G25470	AP2_ERF	DREB1C, FTQ4, C...	FREEZING TOLERANCE QTL 4, DRE/...		Potri.001G110800 [exp]	1.41	0.9657
					Potri.016G004500 [exp]	3.46	0.9549
AT4G12410			SAUR-like auxin-responsive pro...		Potri.003G113100 [exp]	4.89	0.9460
AT4G16820		PLA-I{beta]2	phospholipase A I beta 2, alph...		Potri.001G153100 [exp]	11.83	0.9354
AT1G76650		CML38	calmodulin-like 38 (.1.2.3)		Potri.005G259900 [exp]	12.96	0.9208
AT4G37260	MYB	ATMYB73	myb domain protein 73 (.1)		Potri.002G128900 [exp]	15.09	0.9645
AT1G18350		ATMKK7, BUD1	MAP KINASE KINASE7, BUSHY AND ...		Potri.008G183700 [exp]	17.32	0.9317
AT5G59820	C2H2ZnF	ZAT12, RHL41	RESPONSIVE TO HIGH LIGHT 41, C...		Potri.009G027700 [exp]	18.02	0.9268	RHL41.1
AT1G11050			Protein kinase superfamily pro...		Potri.005G181800 [exp]	20.00	0.9594

Compare expression of checked genes

Potri.004G141200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.