Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G50940 169 / 3e-50 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT3G50930 168 / 6e-49 BCS1 cytochrome BC1 synthesis (.1) AT5G17760 158 / 5e-47 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2) AT2G18193 160 / 1e-46 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT2G18190 157 / 3e-45 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT5G17740 150 / 3e-42 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT5G17730 149 / 3e-42 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT5G17750 145 / 1e-41 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT3G28580 140 / 9e-39 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT3G28510 135 / 5e-37 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G012400 [exp] 310 / 1e-104 AT3G50940 367 / 2e-123 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.007G020800 [exp] 182 / 2e-54 AT5G17760 506 / 1e-176 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2) Potri.005G119900 [exp] 178 / 4e-53 AT5G17760 512 / 3e-179 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2) Potri.007G020900 [exp] 165 / 2e-48 AT3G50930 561 / 0.0 cytochrome BC1 synthesis (.1) Potri.007G020600 [exp] 162 / 4e-47 AT2G18193 553 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.008G177200 [exp] 160 / 3e-46 AT3G50940 401 / 4e-136 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.007G020500 [exp] 158 / 6e-46 AT2G18193 511 / 1e-179 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.015G067400 [exp] 150 / 1e-42 AT5G40010 538 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1) Potri.002G032700 [exp] 149 / 1e-42 AT3G50930 437 / 1e-149 cytochrome BC1 synthesis (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028463 [exp] 225 / 2e-71 AT3G50930 340 / 2e-111 cytochrome BC1 synthesis (.1) Lus10041918 [exp] 224 / 5e-70 AT3G50930 383 / 2e-126 cytochrome BC1 synthesis (.1) Lus10015802 [exp] 166 / 1e-48 AT3G50940 462 / 9e-161 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10014284 [exp] 162 / 5e-47 AT3G50930 535 / 0.0 cytochrome BC1 synthesis (.1) Lus10037004 [exp] 160 / 1e-46 AT3G50930 457 / 9e-159 cytochrome BC1 synthesis (.1) Lus10025989 [exp] 158 / 2e-46 AT3G50930 445 / 1e-153 cytochrome BC1 synthesis (.1) Lus10003213 [exp] 152 / 3e-43 AT5G17740 430 / 7e-146 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10042166 [exp] 149 / 8e-42 AT5G40010 526 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1) Lus10024275 [exp] 147 / 2e-41 AT3G50940 434 / 2e-149 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10032188 [exp] 146 / 3e-41 AT5G40010 497 / 4e-173 ATPase-in-Seed-Development, AAA-ATPase 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF00004 [poplar] [flax] AAA ATPase family associated with various cellular activities (AAA)
Representative CDS sequence Show only first row Show all	>Potri.005G115200.2 pacid=42805151 polypeptide=Potri.005G115200.2.p locus=Potri.005G115200 ID=Potri.005G115200.2.v4.1 annot-version=v4.1 ATGCATTGTCACAAGCCACTTCACTTCACTTACCTTTCTCCTCGTCAGGAAATTCCAGTGAATTATGCAGCACTCCAGTATGAGCTGAAATGGTATGAGC TTTGCTTTCATAAGCGACATGCCTGTATGATCAGGAAAAAGTATCTGCCTTGCATTCTTGAAATGGCTAAGAAAATTAAAGATCAAAACAGGGTAGTAAA GTTTTACACTACTCGCGGGGGACGTGATGGATGGAGCTGTAAGGGGAAAGGGATCAATTTGGATCACCCTATGACTTTTGATACGCTAGCAATGGATGGA AACCTCAAACAAAAAGTTATAGAGGATCTTGATAAATTCATCAAGGGAAAGGAGTGTTACAAGAGGATTGGTAAAGTATGGAAACGGGGCTATTTGCTGT ACGGCCCTCTCGGAACTGGGAAATCAAGCTTGATAGCAGCCATGGCCAATCATCTTAATTTTGATATCTACAACTTGAAACTGCTGCTGTCAGTTCTGAT CCTTCCCTGGAGTTTTTGTTACTTCAATATGTCCAATCATTCAATTCTTGTGGTGGAAGATATCAACTATTCGATAGAGCTACAGATTCGTGAAGCGGGG AATCATCCATCAGATCATGATCGAACTCCTCGGCGGCCTTGGGTTGGATTTTTATTTTGTTGTTATTCATTTTTTATCTCATAA
AA sequence Show only first row Show all	>Potri.005G115200.2 pacid=42805151 polypeptide=Potri.005G115200.2.p locus=Potri.005G115200 ID=Potri.005G115200.2.v4.1 annot-version=v4.1 MHCHKPLHFTYLSPRQEIPVNYAALQYELKWYELCFHKRHACMIRKKYLPCILEMAKKIKDQNRVVKFYTTRGGRDGWSCKGKGINLDHPMTFDTLAMDG NLKQKVIEDLDKFIKGKECYKRIGKVWKRGYLLYGPLGTGKSSLIAAMANHLNFDIYNLKLLLSVLILPWSFCYFNMSNHSILVVEDINYSIELQIREAG NHPSDHDRTPRRPWVGFLFCCYSFFIS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G50940			P-loop containing nucleoside t...		Potri.005G115200 [exp]	0	1
					Potri.014G061800 [exp]	5.09	0.7117
					Potri.005G071951 [exp]	12.84	0.7101
					Potri.012G055401 [exp]	22.22	0.8000
AT5G09550			GDP dissociation inhibitor fam...		Potri.007G115300 [exp]	27.16	0.6977
AT5G53040		GRD, RKD4	RWP-RK domain-containing 4, GR...		Potri.015G011800 [exp]	45.59	0.7280
AT5G16080		ATCXE17	carboxyesterase 17 (.1)		Potri.006G253300 [exp]	49.95	0.6516
AT5G03610			GDSL-like Lipase/Acylhydrolase...		Potri.010G236951 [exp]	53.47	0.7189
AT1G70790			Calcium-dependent lipid-bindin...		Potri.010G110900 [exp]	62.93	0.6989
AT4G38040			Exostosin family protein (.1)		Potri.007G117800 [exp]	110.02	0.6040
AT5G15110			Pectate lyase family protein (...		Potri.015G064700 [exp]	143.47	0.5972

Compare expression of checked genes

Potri.005G115200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.