Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G67190 169 / 2e-53 AP2_ERF DEAR2 DREB and EAR motif protein 2 (.1) AT2G23340 168 / 2e-53 AP2_ERF DEAR3 DREB and EAR motif protein 3 (.1) AT3G50260 155 / 7e-49 AP2_ERF DEAR1, CEJ1, ATERF#011 DREB AND EAR MOTIF PROTEIN 1, cooperatively regulated by ethylene and jasmonate 1 (.1) AT4G36900 155 / 3e-48 AP2_ERF DEAR4, RAP2.10 DREB AND EAR MOTIF PROTEIN 4, related to AP2 10 (.1) AT4G06746 145 / 5e-45 AP2_ERF DEAR5, RAP2.9 DREB AND EAR MOTIF PROTEIN 5, related to AP2 9 (.1) AT1G46768 142 / 2e-43 AP2_ERF RAP2.1 related to AP2 1 (.1) AT1G21910 96 / 1e-24 AP2_ERF DREB26 dehydration response element-binding protein 26, Integrase-type DNA-binding superfamily protein (.1) AT4G16750 95 / 1e-24 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT1G71450 94 / 3e-24 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT1G19210 92 / 2e-23 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G046500 [exp] 262 / 2e-90 AT5G67190 149 / 7e-46 DREB and EAR motif protein 2 (.1) Potri.002G124000 [exp] 161 / 5e-51 AT1G46768 158 / 3e-50 related to AP2 1 (.1) Potri.014G025200 [exp] 159 / 4e-50 AT1G46768 160 / 3e-51 related to AP2 1 (.1) Potri.003G079300 [exp] 100 / 3e-26 AT4G16750 150 / 7e-46 Integrase-type DNA-binding superfamily protein (.1) Potri.019G073300 [exp] 99 / 5e-26 AT1G22810 144 / 1e-44 Integrase-type DNA-binding superfamily protein (.1) Potri.013G100300 [exp] 98 / 7e-26 AT1G22810 140 / 5e-43 Integrase-type DNA-binding superfamily protein (.1) Potri.006G138900 [exp] 96 / 2e-25 AT5G21960 86 / 3e-21 Integrase-type DNA-binding superfamily protein (.1) Potri.018G038100 [exp] 96 / 2e-25 AT5G21960 100 / 5e-27 Integrase-type DNA-binding superfamily protein (.1) Potri.013G101100 [exp] 95 / 1e-24 AT1G71450 184 / 1e-59 Integrase-type DNA-binding superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009373 [exp] 174 / 4e-56 AT5G67190 164 / 3e-52 DREB and EAR motif protein 2 (.1) Lus10018727 [exp] 160 / 3e-50 AT5G67190 162 / 1e-51 DREB and EAR motif protein 2 (.1) Lus10010043 [exp] 147 / 2e-45 AT2G23340 170 / 1e-54 DREB and EAR motif protein 3 (.1) Lus10033420 [exp] 95 / 3e-24 AT1G19210 181 / 4e-58 Integrase-type DNA-binding superfamily protein (.1) Lus10038082 [exp] 95 / 5e-24 AT5G21960 155 / 3e-47 Integrase-type DNA-binding superfamily protein (.1) Lus10009798 [exp] 93 / 5e-24 AT1G19210 132 / 1e-39 Integrase-type DNA-binding superfamily protein (.1) Lus10009468 [exp] 88 / 2e-22 AT1G22810 132 / 1e-40 Integrase-type DNA-binding superfamily protein (.1) Lus10002801 [exp] 90 / 3e-22 AT5G11590 209 / 4e-68 TINY2, Integrase-type DNA-binding superfamily protein (.1) Lus10001601 [exp] 90 / 3e-22 AT5G11590 159 / 1e-48 TINY2, Integrase-type DNA-binding superfamily protein (.1) Lus10043240 [exp] 90 / 4e-22 AT5G11590 176 / 1e-54 TINY2, Integrase-type DNA-binding superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0081 [poplar] [flax] MBD-like PF00847 [poplar] [flax] AP2 AP2 domain
Representative CDS sequence Show only first row Show all	>Potri.005G140900.1 pacid=42804885 polypeptide=Potri.005G140900.1.p locus=Potri.005G140900 ID=Potri.005G140900.1.v4.1 annot-version=v4.1 ATGGAAAGCGGGGTAGACAAGGAGATGGCGACAAGAAAGAGAGGAGGGATGGGGAGTGAGAGGCAATACAAGGGAATAAGGATGAGGAAGTGGGGAAAAT GGGTGGCTGAGATAAGAGAGCCTAACAAAAGGTCAAGGATTTGGCTTGGTTCGTACTCAACACCTGTAGCGGCGGCTCGCGCTTATGACACCGCCGTTTT TTATTTGAGAGGACCGTCGGCGAGGTTGAATTTTCCTGAATTTTTGGCTGGAGAGAATTTTAGCTGCGGTGGATCATATGGGGACATGTCAGCTGCTTCT ATAAGGAAAAGAGCAACCGAGGTTGGAGCTCGTGTCGATGCTTTTGAGACAGCGTTAAACCACCACCACCACCGCCATCACGATGACCGTCAAAGAAATA GTAGTAATAGTACCAGTAGCAATGATAATAATGAAACGGTCGTTGATAGTAGAGAGTTAAAATCACGGCCGGTTGACCTGAATAAGGTGCCTGACCCAGA GGATTCCGATGGAGATGAGTGGGAGAGGAGTTTAGCCACCGGTGGTAATCCGATGGGTTGCTAA
AA sequence Show only first row Show all	>Potri.005G140900.1 pacid=42804885 polypeptide=Potri.005G140900.1.p locus=Potri.005G140900 ID=Potri.005G140900.1.v4.1 annot-version=v4.1 MESGVDKEMATRKRGGMGSERQYKGIRMRKWGKWVAEIREPNKRSRIWLGSYSTPVAAARAYDTAVFYLRGPSARLNFPEFLAGENFSCGGSYGDMSAAS IRKRATEVGARVDAFETALNHHHHRHHDDRQRNSSNSTSSNDNNETVVDSRELKSRPVDLNKVPDPEDSDGDEWERSLATGGNPMGC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G67190	AP2_ERF	DEAR2	DREB and EAR motif protein 2 (...		Potri.005G140900 [exp]	0	1
					Potri.003G152250 [exp]	16.55	0.6679
					Potri.003G152300 [exp]	18.43	0.6609
AT4G12040		AtSAP7	stress-associated protein 7, A...		Potri.001G115000 [exp]	33.67	0.6530
AT5G47100		ATCBL9, CBL9	calcineurin B-like protein 9 (...		Potri.003G084200 [exp]	38.57	0.6560
AT4G18700		ATWL4, CIPK12, ...	SNF1-RELATED PROTEIN KINASE 3....		Potri.004G058300 [exp]	40.98	0.6383
					Potri.010G118500 [exp]	72.51	0.6288
AT2G33610		CHB2, ATSWI3B	CHROMATIN REMODELING COMPLEX S...		Potri.002G004800 [exp]	85.09	0.5598	(),CHB903,Pt-SWI3.1,of
AT4G02350		SEC15B	exocyst complex component sec1...		Potri.014G127400 [exp]	89.88	0.5274
AT1G75390	bZIP	ATBZIP44	basic leucine-zipper 44 (.1.2)		Potri.005G231300 [exp]	97.65	0.6076	Pt-GBF5.1
AT1G31460			unknown protein		Potri.001G128600 [exp]	111.32	0.5927

Compare expression of checked genes

Potri.005G140900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.