Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G80830 117 / 3e-31 ATNRAMP1, PMIT1, NRAMP1 natural resistance-associated macrophage protein 1 (.1) AT1G15960 115 / 2e-30 ATNRAMP6, NRAMP6 NRAMP metal ion transporter 6 (.1) AT5G67330 99 / 1e-24 ATNRAMP4 ARABIDOPSIS THALIANA NATURAL RESISTANCE ASSOCIATED MACROPHAGE PROTEIN 4, natural resistance associated macrophage protein 4 (.1) AT1G47240 96 / 3e-23 ATNRAMP2, NRAMP2 NRAMP metal ion transporter 2 (.1) AT2G23150 95 / 3e-23 ATNRAMP3, NRAMP3 natural resistance-associated macrophage protein 3 (.1) AT4G18790 86 / 5e-20 ATNRAMP5, NRAMP5 NRAMP metal ion transporter family protein (.1) AT5G03280 64 / 4e-12 CKR1, PIR2, ORE3, ORE2, ERA3, EIN2, ATEIN2 ORESARA 3, ORESARA 2, ENHANCED RESPONSE TO ABA3, ETHYLENE INSENSITIVE 2, CYTOKININ RESISTANT 1, NRAMP metal ion transporter family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G080500 [exp] 171 / 4e-51 AT1G80830 590 / 0.0 natural resistance-associated macrophage protein 1 (.1) Potri.002G080400 [exp] 157 / 6e-46 AT1G80830 546 / 0.0 natural resistance-associated macrophage protein 1 (.1) Potri.005G181100 [exp] 153 / 3e-44 AT1G80830 550 / 0.0 natural resistance-associated macrophage protein 1 (.1) Potri.005G181000 [exp] 150 / 4e-43 AT1G80830 571 / 0.0 natural resistance-associated macrophage protein 1 (.1) Potri.001G044900 [exp] 115 / 1e-30 AT1G15960 744 / 0.0 NRAMP metal ion transporter 6 (.1) Potri.002G121000 [exp] 97 / 8e-24 AT1G47240 790 / 0.0 NRAMP metal ion transporter 2 (.1) Potri.007G050600 [exp] 86 / 4e-20 AT2G23150 765 / 0.0 natural resistance-associated macrophage protein 3 (.1) Potri.007G050700 [exp] 84 / 2e-19 AT2G23150 768 / 0.0 natural resistance-associated macrophage protein 3 (.1) Potri.006G127100 [exp] 68 / 2e-13 AT5G03280 1261 / 0.0 ORESARA 3, ORESARA 2, ENHANCED RESPONSE TO ABA3, ETHYLENE INSENSITIVE 2, CYTOKININ RESISTANT 1, NRAMP metal ion transporter family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028542 [exp] 127 / 2e-34 AT1G15960 624 / 0.0 NRAMP metal ion transporter 6 (.1) Lus10018132 [exp] 126 / 2e-34 AT1G15960 623 / 0.0 NRAMP metal ion transporter 6 (.1) Lus10041652 [exp] 113 / 1e-29 AT1G15960 826 / 0.0 NRAMP metal ion transporter 6 (.1) Lus10024069 [exp] 112 / 3e-29 AT1G15960 822 / 0.0 NRAMP metal ion transporter 6 (.1) Lus10010395 [exp] 97 / 9e-24 AT1G47240 759 / 0.0 NRAMP metal ion transporter 2 (.1) Lus10014868 [exp] 97 / 1e-23 AT1G47240 763 / 0.0 NRAMP metal ion transporter 2 (.1) Lus10004317 [exp] 96 / 2e-23 AT1G47240 793 / 0.0 NRAMP metal ion transporter 2 (.1) Lus10032853 [exp] 96 / 2e-23 AT1G47240 793 / 0.0 NRAMP metal ion transporter 2 (.1) Lus10013804 [exp] 64 / 4e-12 AT5G03280 1076 / 0.0 ORESARA 3, ORESARA 2, ENHANCED RESPONSE TO ABA3, ETHYLENE INSENSITIVE 2, CYTOKININ RESISTANT 1, NRAMP metal ion transporter family protein (.1) Lus10026517 [exp] 63 / 8e-12 AT5G03280 1057 / 0.0 ORESARA 3, ORESARA 2, ENHANCED RESPONSE TO ABA3, ETHYLENE INSENSITIVE 2, CYTOKININ RESISTANT 1, NRAMP metal ion transporter family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0062 [poplar] [flax] APC PF01566 [poplar] [flax] Nramp Natural resistance-associated macrophage protein
Representative CDS sequence Show only first row Show all	>Potri.005G180900.2 pacid=42803077 polypeptide=Potri.005G180900.2.p locus=Potri.005G180900 ID=Potri.005G180900.2.v4.1 annot-version=v4.1 ATGGGTAGCCTGCAGCAGGAACAGCAATTGTGCGATCAGAATGCTAATACATCACCGGGAAAAAGCGAGCGTATAGCAGCTCTTGACTTGGATGGCCAGT CCCGTCCCCACCTTGCACTGATCATGACCAGCAGGTCCATATCATTCTCTCATGTTAAGCTCGTTTTTGGGTTTCTCTGCCATCATATTCTTTGGAAGAA AAAACACCGAGCTTTTCCTGATCTACGACCCGGTTTTCTTGTTTCATTAGCTTATCTTGATCCTGGAAACTTGGAAACAGATTTGCAAGCAGGAGCCAAC CATGGATACGACCTGTTATGGGTTATACTTATTGGTTTGATCTTCGCTCTCGCCATCCGATCTCTTGCTGCAAATCTCGGTGTAAGCACCGGTAAATACT TGTCCGAATTGTGCAAGGTGGAGTATCCAAAGTTTTGGTTGCAGGCAGAGGTAGCTGTCGTAGCTGCTGATATACCTGGAGGCATGTGTAAATTCGATTA CCGTTAA
AA sequence Show only first row Show all	>Potri.005G180900.2 pacid=42803077 polypeptide=Potri.005G180900.2.p locus=Potri.005G180900 ID=Potri.005G180900.2.v4.1 annot-version=v4.1 MGSLQQEQQLCDQNANTSPGKSERIAALDLDGQSRPHLALIMTSRSISFSHVKLVFGFLCHHILWKKKHRAFPDLRPGFLVSLAYLDPGNLETDLQAGAN HGYDLLWVILIGLIFALAIRSLAANLGVSTGKYLSELCKVEYPKFWLQAEVAVVAADIPGGMCKFDYR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G80830		ATNRAMP1, PMIT1...	natural resistance-associated ...		Potri.005G180900 [exp]	0	1
AT1G53240		mMDH1	mitochondrial malate dehydroge...		Potri.017G152000 [exp]	5.65	0.6581
AT5G08240			unknown protein		Potri.019G119000 [exp]	6.48	0.6829
AT5G14180		MPL1	Myzus persicae-induced lipase ...		Potri.014G159700 [exp]	15.84	0.7219
AT5G17230		PSY	PHYTOENE SYNTHASE (.1.2.3)		Potri.003G217950 [exp]	68.75	0.5685
					Potri.004G061350 [exp]	99.13	0.5630

Compare expression of checked genes

Potri.005G180900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.