Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G40260 100 / 2e-24 GARP Homeodomain-like superfamily protein (.1) AT2G42660 96 / 7e-24 GARP Homeodomain-like superfamily protein (.1) AT1G14600 96 / 1e-23 GARP Homeodomain-like superfamily protein (.1) AT2G38300 95 / 6e-23 GARP myb-like HTH transcriptional regulator family protein (.1) AT2G02060 94 / 7e-23 GARP Homeodomain-like superfamily protein (.1) AT4G04580 89 / 6e-22 GARP Homeodomain-like superfamily protein (.1) AT3G12730 84 / 2e-19 GARP Homeodomain-like superfamily protein (.1) AT5G42630 83 / 4e-19 GARP KAN4, KANADI4, ATS KANADI 4, ABERRANT TESTA SHAPE, Homeodomain-like superfamily protein (.1.2) AT4G17695 83 / 1e-18 GARP KAN3, KANADI3 KANADI 3, Homeodomain-like superfamily protein (.1) AT1G32240 82 / 8e-18 GARP KAN2, KANADI2 KANADI 2, Homeodomain-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G056700 [exp] 341 / 4e-120 AT1G14600 93 / 1e-22 Homeodomain-like superfamily protein (.1) Potri.010G099600 [exp] 105 / 5e-27 AT1G14600 126 / 9e-35 Homeodomain-like superfamily protein (.1) Potri.008G142000 [exp] 104 / 1e-26 AT1G14600 130 / 2e-36 Homeodomain-like superfamily protein (.1) Potri.004G057900 [exp] 102 / 2e-25 AT2G38300 139 / 7e-38 myb-like HTH transcriptional regulator family protein (.1) Potri.011G006350 [exp] 100 / 2e-25 AT2G02060 115 / 8e-31 Homeodomain-like superfamily protein (.1) Potri.008G071700 [exp] 98 / 6e-24 AT2G40260 166 / 2e-47 Homeodomain-like superfamily protein (.1) Potri.010G185700 [exp] 98 / 7e-24 AT2G40260 188 / 5e-56 Homeodomain-like superfamily protein (.1) Potri.009G075100 [exp] 97 / 1e-23 AT2G38300 162 / 4e-47 myb-like HTH transcriptional regulator family protein (.1) Potri.011G067150 [exp] 97 / 2e-23 AT2G38300 128 / 1e-33 myb-like HTH transcriptional regulator family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001149 [exp] 99 / 1e-24 AT2G40260 119 / 1e-30 Homeodomain-like superfamily protein (.1) Lus10002207 [exp] 98 / 4e-24 AT2G38300 171 / 9e-51 myb-like HTH transcriptional regulator family protein (.1) Lus10035093 [exp] 99 / 5e-24 AT1G14600 103 / 1e-25 Homeodomain-like superfamily protein (.1) Lus10012239 [exp] 97 / 1e-23 AT2G38300 170 / 3e-50 myb-like HTH transcriptional regulator family protein (.1) Lus10040945 [exp] 94 / 2e-22 AT2G40260 159 / 2e-45 Homeodomain-like superfamily protein (.1) Lus10007279 [exp] 87 / 4e-21 AT2G38300 107 / 1e-28 myb-like HTH transcriptional regulator family protein (.1) Lus10029225 [exp] 87 / 5e-21 AT2G38300 110 / 5e-30 myb-like HTH transcriptional regulator family protein (.1) Lus10029808 [exp] 85 / 7e-21 AT1G14600 87 / 8e-22 Homeodomain-like superfamily protein (.1) Lus10007513 [exp] 87 / 5e-20 AT2G40260 145 / 3e-40 Homeodomain-like superfamily protein (.1) Lus10017442 [exp] 87 / 8e-20 AT2G38300 148 / 3e-41 myb-like HTH transcriptional regulator family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0123 [poplar] [flax] HTH PF00249 [poplar] [flax] Myb_DNA-binding Myb-like DNA-binding domain
Representative CDS sequence Show only first row Show all	>Potri.005G205900.2 pacid=42803741 polypeptide=Potri.005G205900.2.p locus=Potri.005G205900 ID=Potri.005G205900.2.v4.1 annot-version=v4.1 ATGAAAACATCACGGAAAAATGGAGTAAGGCAATACAACAAATCTGAACATCCACGTCTCCGGTGGACTCCTGAGCTCCATGAACATTTTGTTGAAGCTG TTGAACGCCTCGGTGGAAAATACAAAGCAACACCTAGGCGAATTCTGCAGATGATGGGCGTGAAAGAACTGAAGATTTCTCATATCAAAAGCCATCTTCA GATGTACAGAAGCATGAAGGGTCCCAAAAACATCAATGTCTTAATACCCATGAAGAAGCATCTGCAAGCAGAAAGAACACAACTTGATGACATGGGAATC TCCTCAATTTTCTCCTCTCAGAGGCTACTACAAGGTGAGTACTTGATGCAAATGGAATCTGAGAAGTCTGATTCTAAACATGATATATTTTCTGATGAAA GCAATGGACTCCAGCTAACAAAAGAAGACGGTGGTGACCCGGAGCAACAGGATTCAGGCACAAGCTTTGTTGGTAGAACGTCTATGGAAGAAAATATTGA CAGGCTACCAGCTGAAACCTGTGAGCTCTCACTTTCTTTCACCCCATCAATGTCGTGCTGTACTGCTGAAGAAAGAGAGTTATGGCCATTAATTAACGAT CAGCAACGTGAGTATAATTCAACAACTAGTTTCATAAGCAGACCAGATCAGTTCGACTGTGGGAGTAATCACATAAACTTAGACCTAACCATCGGAACAT GA
AA sequence Show only first row Show all	>Potri.005G205900.2 pacid=42803741 polypeptide=Potri.005G205900.2.p locus=Potri.005G205900 ID=Potri.005G205900.2.v4.1 annot-version=v4.1 MKTSRKNGVRQYNKSEHPRLRWTPELHEHFVEAVERLGGKYKATPRRILQMMGVKELKISHIKSHLQMYRSMKGPKNINVLIPMKKHLQAERTQLDDMGI SSIFSSQRLLQGEYLMQMESEKSDSKHDIFSDESNGLQLTKEDGGDPEQQDSGTSFVGRTSMEENIDRLPAETCELSLSFTPSMSCCTAEERELWPLIND QQREYNSTTSFISRPDQFDCGSNHINLDLTIGT

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G40260	GARP		Homeodomain-like superfamily p...		Potri.005G205900 [exp]	0	1
AT3G47570			Leucine-rich repeat protein ki...		Potri.006G273001 [exp]	2.00	0.9143
AT2G38870			Serine protease inhibitor, pot...		Potri.010G075200 [exp]	2.00	0.9171
AT1G14700		PAP3, ATPAP3	purple acid phosphatase 3 (.1....		Potri.008G139100 [exp]	7.14	0.8806	Pt-PAP8.3
AT4G13620	AP2_ERF		Integrase-type DNA-binding sup...		Potri.017G055400 [exp]	7.74	0.8521
AT3G51680		AtSDR2	short-chain dehydrogenase/redu...		Potri.016G129100 [exp]	8.00	0.8797
AT1G03430		AHP5	histidine-containing phosphotr...		Potri.014G136200 [exp]	8.66	0.8722	Pt-HPT2.1
AT2G13650		GONST1	golgi nucleotide sugar transpo...		Potri.007G106400 [exp]	11.48	0.8260
AT1G58420			Uncharacterised conserved prot...		Potri.007G006100 [exp]	13.49	0.8512
AT2G24130			Leucine-rich receptor-like pro...		Potri.018G103400 [exp]	16.12	0.8557
AT5G25930			Protein kinase family protein ...		Potri.018G057100 [exp]	16.43	0.8559

Compare expression of checked genes

Potri.005G205900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.