Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G23230 102 / 2e-28 AP2_ERF ERF98 Integrase-type DNA-binding superfamily protein (.1) AT1G04370 77 / 1e-18 AP2_ERF ATERF14 Ethylene-responsive element binding factor 14 (.1) AT3G23240 76 / 1e-17 AP2_ERF ERF1, ATERF1 ethylene response factor 1 (.1) AT5G07580 74 / 2e-16 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT5G61590 72 / 3e-16 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT2G31230 72 / 7e-16 AP2_ERF ATERF15 ethylene-responsive element binding factor 15 (.1) AT2G44840 72 / 7e-16 AP2_ERF ATERF13, EREBP ethylene-responsive element binding factor 13 (.1) AT5G43410 69 / 8e-16 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT3G23220 69 / 1e-15 AP2_ERF ESE1 ethylene and salt inducible 1, Integrase-type DNA-binding superfamily protein (.1) AT5G47220 71 / 2e-15 AP2_ERF ATERF-2, ERF2, ATERF2 ETHYLENE RESPONSE FACTOR- 2, ethylene responsive element binding factor 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G039200 [exp] 181 / 9e-60 AT3G23230 113 / 7e-33 Integrase-type DNA-binding superfamily protein (.1) Potri.008G166100 [exp] 105 / 9e-30 AT3G23230 82 / 2e-20 Integrase-type DNA-binding superfamily protein (.1) Potri.010G072400 [exp] 102 / 1e-28 AT3G23230 85 / 1e-21 Integrase-type DNA-binding superfamily protein (.1) Potri.010G072600 [exp] 82 / 1e-20 AT3G23220 91 / 4e-24 ethylene and salt inducible 1, Integrase-type DNA-binding superfamily protein (.1) Potri.008G166000 [exp] 79 / 1e-19 AT3G23230 94 / 3e-25 Integrase-type DNA-binding superfamily protein (.1) Potri.003G151000 [exp] 76 / 2e-17 AT5G07580 164 / 6e-50 Integrase-type DNA-binding superfamily protein (.1) Potri.002G039300 [exp] 73 / 4e-17 AT3G23220 82 / 2e-20 ethylene and salt inducible 1, Integrase-type DNA-binding superfamily protein (.1) Potri.002G039100 [exp] 74 / 1e-16 AT3G23240 147 / 3e-44 ethylene response factor 1 (.1) Potri.005G223200 [exp] 73 / 2e-16 AT3G23240 165 / 4e-51 ethylene response factor 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011830 [exp] 91 / 7e-24 AT3G23230 134 / 4e-41 Integrase-type DNA-binding superfamily protein (.1) Lus10024883 [exp] 90 / 2e-23 AT3G23230 130 / 3e-39 Integrase-type DNA-binding superfamily protein (.1) Lus10022936 [exp] 86 / 1e-22 AT3G23230 114 / 9e-34 Integrase-type DNA-binding superfamily protein (.1) Lus10021873 [exp] 87 / 6e-22 AT3G23230 143 / 4e-44 Integrase-type DNA-binding superfamily protein (.1) Lus10011831 [exp] 83 / 6e-21 AT3G23230 132 / 2e-40 Integrase-type DNA-binding superfamily protein (.1) Lus10021196 [exp] 82 / 7e-21 AT3G23230 131 / 3e-40 Integrase-type DNA-binding superfamily protein (.1) Lus10033884 [exp] 72 / 8e-17 AT3G23230 125 / 9e-38 Integrase-type DNA-binding superfamily protein (.1) Lus10032499 [exp] 72 / 1e-15 AT5G51190 186 / 8e-59 Integrase-type DNA-binding superfamily protein (.1) Lus10042996 [exp] 72 / 1e-15 AT5G51190 189 / 6e-60 Integrase-type DNA-binding superfamily protein (.1) Lus10042907 [exp] 70 / 4e-15 AT2G44840 135 / 5e-39 ethylene-responsive element binding factor 13 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0081 [poplar] [flax] MBD-like PF00847 [poplar] [flax] AP2 AP2 domain
Representative CDS sequence Show only first row Show all	>Potri.005G223100.1 pacid=42802919 polypeptide=Potri.005G223100.1.p locus=Potri.005G223100 ID=Potri.005G223100.1.v4.1 annot-version=v4.1 ATGGAAACACATCAAGGAGAGAAGAACACAAAGAAGCAAGAGAAAGGAAGGGGGGAGAATGCGTATAGGGGAATTCGCAGGCGACCTTGGGGTAAGTTTG CTGCCGAGATACGTGACCCAACAAAGAATGGGGCACGTCGTTGGCTAGGAACATATGACACGGCGGAGGAGGCGGCTCGGGCATATGACCGAGCTGCTTT TGCCTTCCGGGGTCATTTAGCCATTCTCAATTTCCCGAATGAATACCAACATCAGGATCCAAGCTCTGCCATGTCATTTGCTTCTTCATCTTCATTCTCC ACTGCCAATCCTGTGAATTATGGCCATGAAGTTTCCTCTACTGGCGGACAAGAAGTTATAGAGTTCGAGTATTTGGATAACAAATTGTTGGAGGAGCTGC TGGGAACGAATGATCCCAGCAGGCAGCATTAG
AA sequence Show only first row Show all	>Potri.005G223100.1 pacid=42802919 polypeptide=Potri.005G223100.1.p locus=Potri.005G223100 ID=Potri.005G223100.1.v4.1 annot-version=v4.1 METHQGEKNTKKQEKGRGENAYRGIRRRPWGKFAAEIRDPTKNGARRWLGTYDTAEEAARAYDRAAFAFRGHLAILNFPNEYQHQDPSSAMSFASSSSFS TANPVNYGHEVSSTGGQEVIEFEYLDNKLLEELLGTNDPSRQH

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G23230	AP2_ERF	ERF98	Integrase-type DNA-binding sup...		Potri.005G223100 [exp]	0	1
AT5G12340			unknown protein		Potri.009G071100 [exp]	2.82	0.9664
AT1G30760			FAD-binding Berberine family p...		Potri.011G159400 [exp]	3.46	0.9495
AT5G05600			2-oxoglutarate (2OG) and Fe(II...		Potri.010G188000 [exp]	4.00	0.9352
AT2G26190			calmodulin-binding family prot...		Potri.006G147900 [exp]	4.69	0.9327
AT2G41180		SIB2	sigma factor binding protein 2...		Potri.019G013300 [exp]	5.29	0.9362
AT2G31180	MYB	ATMYB14, Myb14a...	ARABIDOPSIS THALIANA MYB DOMAI...		Potri.002G038500 [exp]	5.65	0.9446	Pt-GMMYB29.2
AT5G47710			Calcium-dependent lipid-bindin...		Potri.016G005300 [exp]	6.48	0.9404
AT4G05100	MYB	ATMYB74	myb domain protein 74 (.1)		Potri.004G026600 [exp]	8.94	0.9438
AT2G45760		BAL, BAP2	BON ASSOCIATION PROTEIN 1-LIKE...		Potri.002G155300 [exp]	9.00	0.9351	BAP2.1
AT3G25780		AOC3, AOC2	allene oxide cyclase 3 (.1)		Potri.004G102500 [exp]	10.19	0.9284	MANG.1

Compare expression of checked genes

Potri.005G223100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.