Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G20580 211 / 4e-72 Small nuclear ribonucleoprotein family protein (.1) AT1G76300 201 / 4e-68 SMD3 snRNP core protein SMD3 (.1) AT5G27720 61 / 9e-13 LSM4, EMB1644 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1) AT4G02840 52 / 2e-09 Small nuclear ribonucleoprotein family protein (.1.2) AT3G07590 48 / 8e-08 Small nuclear ribonucleoprotein family protein (.1.2) AT1G20600 41 / 9e-05 B3 AP2/B3-like transcriptional factor family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G010200 [exp] 234 / 7e-81 AT1G20580 214 / 5e-73 Small nuclear ribonucleoprotein family protein (.1) Potri.002G205700 [exp] 61 / 1e-12 AT5G27720 179 / 5e-59 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1) Potri.014G130700 [exp] 60 / 4e-12 AT5G27720 176 / 7e-58 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1) Potri.002G054800 [exp] 52 / 2e-09 AT3G07590 183 / 1e-61 Small nuclear ribonucleoprotein family protein (.1.2) Potri.005G207900 [exp] 44 / 2e-06 AT4G02840 152 / 3e-49 Small nuclear ribonucleoprotein family protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012263 [exp] 229 / 4e-79 AT1G20580 219 / 3e-75 Small nuclear ribonucleoprotein family protein (.1) Lus10016013 [exp] 229 / 4e-79 AT1G20580 219 / 3e-75 Small nuclear ribonucleoprotein family protein (.1) Lus10013227 [exp] 229 / 4e-79 AT1G20580 214 / 2e-73 Small nuclear ribonucleoprotein family protein (.1) Lus10030747 [exp] 229 / 4e-79 AT1G20580 214 / 2e-73 Small nuclear ribonucleoprotein family protein (.1) Lus10029426 [exp] 62 / 4e-12 AT5G27720 190 / 2e-58 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1) Lus10004221 [exp] 62 / 5e-12 AT5G27720 182 / 2e-57 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1) Lus10028022 [exp] 49 / 2e-08 AT3G07590 181 / 1e-60 Small nuclear ribonucleoprotein family protein (.1.2) Lus10003727 [exp] 50 / 6e-08 AT3G07590 180 / 1e-58 Small nuclear ribonucleoprotein family protein (.1.2) Lus10025186 [exp] 47 / 2e-07 AT3G07590 169 / 6e-56 Small nuclear ribonucleoprotein family protein (.1.2) Lus10016068 [exp] 47 / 2e-07 AT3G07590 169 / 6e-56 Small nuclear ribonucleoprotein family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0527 [poplar] [flax] Sm-like PF01423 [poplar] [flax] LSM LSM domain
Representative CDS sequence Show only first row Show all	>Potri.005G251100.1 pacid=42802409 polypeptide=Potri.005G251100.1.p locus=Potri.005G251100 ID=Potri.005G251100.1.v4.1 annot-version=v4.1 ATGAGCAGAAGCTTGGGGATTCCGGTGAAGCTACTACACGAGGCTTCCGGTCACATAGTGACGGTGGAGCTGAAGAGTGGAGAGCTTTATAGAGGAGGCA TGGTAGAGTGTGAGGATAACTGGAACTGCCAGCTCGAGAGCATCACTTACACTGCTAAGGATGGGAAGGTCTCACAGCTTGAGCATGTTTTCATTCGTGG CAGTAAAGTCAGATTCATGGTTATACCTGATATGCTAAAGAATGCTCCCATGTTCAAGCGTTTGGATGCTAGAATCAAGGGTAAGAGTGCATCGCTTGGG GTTGGCAGGGGAAGATCTGTTGCAATGCGGTCTAAAGCCCAAGCTGCTGGGCGTGGAGCACCCCCAGGCAGGGGCGTTGTACCACCTGTCAGGAGGTAA
AA sequence Show only first row Show all	>Potri.005G251100.1 pacid=42802409 polypeptide=Potri.005G251100.1.p locus=Potri.005G251100 ID=Potri.005G251100.1.v4.1 annot-version=v4.1 MSRSLGIPVKLLHEASGHIVTVELKSGELYRGGMVECEDNWNCQLESITYTAKDGKVSQLEHVFIRGSKVRFMVIPDMLKNAPMFKRLDARIKGKSASLG VGRGRSVAMRSKAQAAGRGAPPGRGVVPPVRR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G20580			Small nuclear ribonucleoprotei...		Potri.005G251100 [exp]	0	1
AT1G26880			Ribosomal protein L34e superfa...		Potri.015G106466 [exp]	11.00	0.8796
AT1G49410		TOM6	translocase of the outer mitoc...		Potri.004G149200 [exp]	12.00	0.8746	TOM6.1
AT3G06700			Ribosomal L29e protein family ...		Potri.010G142001 [exp]	20.24	0.8582
AT3G10950			Zinc-binding ribosomal protein...		Potri.014G052400 [exp]	21.42	0.8592
AT5G45775			Ribosomal L5P family protein (...		Potri.011G068900 [exp]	26.07	0.8673	Pt-L16.1
AT3G02560			Ribosomal protein S7e family p...		Potri.017G115400 [exp]	28.56	0.8735
AT1G09690			Translation protein SH3-like f...		Potri.001G071100 [exp]	30.46	0.8525	RPL21.2
AT1G77940			Ribosomal protein L7Ae/L30e/S1...		Potri.007G086800 [exp]	35.00	0.8629
AT3G02530			TCP-1/cpn60 chaperonin family ...		Potri.017G113601 [exp]	37.08	0.8575
AT3G02560			Ribosomal protein S7e family p...		Potri.004G099200 [exp]	40.69	0.8604

Compare expression of checked genes

Potri.005G251100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.