Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G32300 76 / 5e-17 UCC1 uclacyanin 1 (.1) AT3G27200 74 / 7e-17 Cupredoxin superfamily protein (.1) AT2G26720 72 / 9e-16 Cupredoxin superfamily protein (.1) AT2G25060 70 / 4e-15 AtENODL14 early nodulin-like protein 14 (.1) AT5G26330 64 / 5e-13 Cupredoxin superfamily protein (.1) AT5G07475 64 / 5e-13 Cupredoxin superfamily protein (.1) AT4G27520 64 / 2e-12 AtENODL2 early nodulin-like protein 2 (.1) AT1G45063 63 / 3e-12 copper ion binding;electron carriers (.1.2) AT4G28365 62 / 5e-12 AtENODL3 early nodulin-like protein 3 (.1) AT3G17675 60 / 5e-12 Cupredoxin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G015200 [exp] 244 / 1e-83 AT3G27200 73 / 1e-16 Cupredoxin superfamily protein (.1) Potri.003G150300 [exp] 76 / 2e-17 AT5G07475 178 / 2e-57 Cupredoxin superfamily protein (.1) Potri.001G080700 [exp] 71 / 1e-15 AT5G07475 164 / 1e-51 Cupredoxin superfamily protein (.1) Potri.001G332200 [exp] 69 / 5e-15 AT3G27200 171 / 5e-55 Cupredoxin superfamily protein (.1) Potri.003G047300 [exp] 67 / 7e-14 AT5G26330 121 / 2e-34 Cupredoxin superfamily protein (.1) Potri.014G049600 [exp] 66 / 1e-13 AT3G60270 111 / 8e-31 Cupredoxin superfamily protein (.1) Potri.007G120200 [exp] 67 / 2e-13 AT2G32300 118 / 3e-32 uclacyanin 1 (.1) Potri.003G183300 [exp] 64 / 6e-13 AT5G15350 123 / 1e-35 early nodulin-like protein 17 (.1) Potri.006G067300 [exp] 62 / 6e-12 AT5G20230 97 / 2e-24 SENESCENCE ASSOCIATED GENE 14, BLUE COPPER BINDING PROTEIN, blue-copper-binding protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010484 [exp] 150 / 2e-46 AT2G32300 87 / 6e-21 uclacyanin 1 (.1) Lus10003799 [exp] 102 / 5e-28 AT2G32300 49 / 1e-07 uclacyanin 1 (.1) Lus10022350 [exp] 76 / 2e-17 AT3G27200 169 / 7e-54 Cupredoxin superfamily protein (.1) Lus10041570 [exp] 75 / 5e-17 AT3G27200 167 / 2e-53 Cupredoxin superfamily protein (.1) Lus10027143 [exp] 74 / 4e-16 AT2G32300 137 / 9e-40 uclacyanin 1 (.1) Lus10027043 [exp] 69 / 1e-14 AT1G72230 112 / 4e-31 Cupredoxin superfamily protein (.1) Lus10025580 [exp] 69 / 2e-14 AT1G72230 112 / 4e-31 Cupredoxin superfamily protein (.1) Lus10010533 [exp] 61 / 7e-12 AT5G26330 174 / 1e-55 Cupredoxin superfamily protein (.1) Lus10026064 [exp] 61 / 1e-11 AT5G15350 113 / 4e-32 early nodulin-like protein 17 (.1) Lus10008720 [exp] 60 / 2e-11 AT1G72230 140 / 2e-42 Cupredoxin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0026 [poplar] [flax] CU_oxidase PF02298 [poplar] [flax] Cu_bind_like Plastocyanin-like domain
Representative CDS sequence Show only first row Show all	>Potri.006G009000.1 pacid=42766883 polypeptide=Potri.006G009000.1.p locus=Potri.006G009000 ID=Potri.006G009000.1.v4.1 annot-version=v4.1 ATGGCAGTGGTCAAGAAGATGTTGATGCTTCTGGTTCTAGTTTCTGTGAGCCTTGGTGTTGGAGCCCAGGTGCACCATATTGTTGGAGGGGAACGTGGCT GGGACCCTTATGCTGATCTTGGTCTTTGGTCCTCCGCTAGAACTTTCAGAGTTGGAGACAAAATTTGGTTCACCCACTCAGCAGCACAGGGTAAAATAGC TGAGGTGGAGACCAAAGAAGAATACCTGACGTGTGATGTGAGCAATCCAATCAGAATGTACACAGATGACATTGATAGCATCTCTCTTGATGGAGAAGGG ATTCGTTACTTCACAAGCAGCAATTCTGGTAAGTGCAAGAGTGGCCTGAAATTACATGTGGAGGTGGTTCCAGAAGGGAAAACTGATACCACCACCGCCA CCCCACAGGTTGTCACATCAGAAAGCTCTGACAAGGCTGTTGCTGCTCCGCCTGAAATTTCAGGTTCAGCCCATATTGGTGCAAGTCTTGCTTTGTTAGT GGCTGGATTTTGGTTGTGCTACATGGGTGTTTAG
AA sequence Show only first row Show all	>Potri.006G009000.1 pacid=42766883 polypeptide=Potri.006G009000.1.p locus=Potri.006G009000 ID=Potri.006G009000.1.v4.1 annot-version=v4.1 MAVVKKMLMLLVLVSVSLGVGAQVHHIVGGERGWDPYADLGLWSSARTFRVGDKIWFTHSAAQGKIAEVETKEEYLTCDVSNPIRMYTDDIDSISLDGEG IRYFTSSNSGKCKSGLKLHVEVVPEGKTDTTTATPQVVTSESSDKAVAAPPEISGSAHIGASLALLVAGFWLCYMGV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G32300		UCC1	uclacyanin 1 (.1)		Potri.006G009000 [exp]	0	1
AT5G57230			Thioredoxin superfamily protei...		Potri.018G143500 [exp]	12.44	0.6795
AT1G69980			unknown protein		Potri.010G039466 [exp]	23.17	0.6410
AT5G11090			serine-rich protein-related (....		Potri.018G120300 [exp]	36.76	0.6242
AT1G24450		NFD2	NUCLEAR FUSION DEFECTIVE 2, Ri...		Potri.012G078400 [exp]	45.36	0.5628
AT1G16010		AtMRS2-1, AtMGT...	magnesium transporter 2 (.1.2....		Potri.001G043200 [exp]	45.44	0.6274
AT5G54980			Uncharacterised protein family...		Potri.010G208300 [exp]	46.74	0.6001
AT5G49610			F-box family protein (.1)		Potri.007G027300 [exp]	47.48	0.5663
AT2G36210			SAUR-like auxin-responsive pro...		Potri.006G211000 [exp]	48.57	0.6188
AT5G22400			Rho GTPase activating protein ...		Potri.016G078200 [exp]	51.73	0.6119
AT3G11530			Vacuolar protein sorting 55 (V...		Potri.006G209100 [exp]	53.66	0.5905

Compare expression of checked genes

Potri.006G009000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.