Potri.006G067300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G20230 96 / 4e-24 SAG14, ATBCB SENESCENCE ASSOCIATED GENE 14, BLUE COPPER BINDING PROTEIN, blue-copper-binding protein (.1)
AT2G31050 95 / 2e-23 Cupredoxin superfamily protein (.1)
AT2G26720 95 / 2e-23 Cupredoxin superfamily protein (.1)
AT2G32300 90 / 5e-21 UCC1 uclacyanin 1 (.1)
AT5G26330 80 / 6e-18 Cupredoxin superfamily protein (.1)
AT3G60270 78 / 2e-17 Cupredoxin superfamily protein (.1)
AT3G17675 76 / 3e-17 Cupredoxin superfamily protein (.1)
AT2G25060 77 / 5e-17 AtENODL14 early nodulin-like protein 14 (.1)
AT4G31840 75 / 2e-16 AtENODL15 early nodulin-like protein 15 (.1)
AT3G20570 76 / 3e-16 AtENODL9 early nodulin-like protein 9 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G129200 181 / 5e-56 AT2G32300 94 / 9e-23 uclacyanin 1 (.1)
Potri.006G067400 115 / 7e-32 AT5G20230 112 / 2e-31 SENESCENCE ASSOCIATED GENE 14, BLUE COPPER BINDING PROTEIN, blue-copper-binding protein (.1)
Potri.001G192100 112 / 3e-30 AT5G20230 100 / 2e-26 SENESCENCE ASSOCIATED GENE 14, BLUE COPPER BINDING PROTEIN, blue-copper-binding protein (.1)
Potri.018G129400 107 / 2e-28 AT5G20230 114 / 6e-32 SENESCENCE ASSOCIATED GENE 14, BLUE COPPER BINDING PROTEIN, blue-copper-binding protein (.1)
Potri.003G047300 89 / 4e-21 AT5G26330 121 / 2e-34 Cupredoxin superfamily protein (.1)
Potri.002G101300 88 / 5e-21 AT1G72230 131 / 6e-39 Cupredoxin superfamily protein (.1)
Potri.002G052500 87 / 9e-21 AT5G26330 130 / 9e-39 Cupredoxin superfamily protein (.1)
Potri.008G151000 87 / 2e-20 AT5G26330 183 / 2e-59 Cupredoxin superfamily protein (.1)
Potri.010G089900 86 / 2e-20 AT5G26330 187 / 7e-61 Cupredoxin superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006657 153 / 2e-44 AT1G45063 106 / 1e-26 copper ion binding;electron carriers (.1.2)
Lus10038098 152 / 7e-44 AT1G45063 107 / 1e-27 copper ion binding;electron carriers (.1.2)
Lus10019405 143 / 3e-40 AT1G45063 107 / 3e-27 copper ion binding;electron carriers (.1.2)
Lus10025752 122 / 1e-33 AT5G20230 101 / 1e-26 SENESCENCE ASSOCIATED GENE 14, BLUE COPPER BINDING PROTEIN, blue-copper-binding protein (.1)
Lus10035911 119 / 2e-32 AT5G20230 95 / 3e-24 SENESCENCE ASSOCIATED GENE 14, BLUE COPPER BINDING PROTEIN, blue-copper-binding protein (.1)
Lus10021925 94 / 5e-23 AT5G26330 170 / 5e-54 Cupredoxin superfamily protein (.1)
Lus10008720 93 / 7e-23 AT1G72230 140 / 2e-42 Cupredoxin superfamily protein (.1)
Lus10010533 92 / 9e-23 AT5G26330 174 / 1e-55 Cupredoxin superfamily protein (.1)
Lus10041211 92 / 2e-22 AT5G26330 167 / 6e-53 Cupredoxin superfamily protein (.1)
Lus10020944 91 / 6e-22 AT1G72230 141 / 1e-42 Cupredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0026 CU_oxidase PF02298 Cu_bind_like Plastocyanin-like domain
Representative CDS sequence
>Potri.006G067300.2 pacid=42770433 polypeptide=Potri.006G067300.2.p locus=Potri.006G067300 ID=Potri.006G067300.2.v4.1 annot-version=v4.1
ATGGCAAGAGGACTCAACATGGCATTCCTTGCAGCAATTGCTATAGCTGCTTTGGTACAAACCTCAGTGGCGCAAACAACCCATACGGTGGGTGACACCA
CAGGTTGGGCCATTCCTACTGGTGATCCTGCTTTCTACTCATCATGGGCTGCAAACCAAACCTTCAATGTTGGTGAAATTCTAGTGTTTAATTTTATGGC
CAACGCACATGATGTTGCCAAGGTGACAAAGGCAGATTATGATGCTTGCACCACAAGCAGTCCCATTTCTTTGGTAGAAACCAGCCCAGCAAGAATCAAC
CTTGACGCTTCAGGAGAGCACTATTTCATTTGCAATTTTACTGGCCATTGCTCTGCTGGTCAAAAGATGATGATCAATGTTAGTGCTGCATCTTCTTCTC
CTTCTCCAGCTCCTCAGACATCTTCTCCTGCTCCTCAACCTTCTACTCCAACTCCTCAGACATCTTCTCCTGCTCCTCAACCTTCTACTCCAACTCCTCA
ACCTTCTCCTTCTCCTCAACCTAGCACTCCTGCTCCTCAACCTAGCACTCCTGCTCCTCAACCTTCTACTCCTGCTCCTCAACCTAGCACTCCTACTCCA
GCTTCTGGTCCATCACCACCTGCACCTACCCCAGCTTCTGGTTCACCACCCTCACCACCAACTGCCACACCACCTACACCTGCCCCAGCTTCTGGTTCAC
CACCCTCACCACCAACTGCCACACCACCTAGTACTGTTGCTCCACCAAACTCTGCCAGATCTCTTGGTTTCGCTGGCTTTACCACTTTCTTGTCCATTTT
TGTAGTTTTTTTGTGCTATTAG
AA sequence
>Potri.006G067300.2 pacid=42770433 polypeptide=Potri.006G067300.2.p locus=Potri.006G067300 ID=Potri.006G067300.2.v4.1 annot-version=v4.1
MARGLNMAFLAAIAIAALVQTSVAQTTHTVGDTTGWAIPTGDPAFYSSWAANQTFNVGEILVFNFMANAHDVAKVTKADYDACTTSSPISLVETSPARIN
LDASGEHYFICNFTGHCSAGQKMMINVSAASSSPSPAPQTSSPAPQPSTPTPQTSSPAPQPSTPTPQPSPSPQPSTPAPQPSTPAPQPSTPAPQPSTPTP
ASGPSPPAPTPASGSPPSPPTATPPTPAPASGSPPSPPTATPPSTVAPPNSARSLGFAGFTTFLSIFVVFLCY

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G20230 SAG14, ATBCB SENESCENCE ASSOCIATED GENE 14,... Potri.006G067300 0 1
AT1G03220 Eukaryotic aspartyl protease f... Potri.002G054900 1.41 0.9350
AT1G67850 Protein of unknown function (D... Potri.008G185600 2.00 0.9077
AT3G18950 Transducin/WD40 repeat-like su... Potri.009G109500 2.44 0.9265
AT5G57500 Galactosyltransferase family p... Potri.018G094000 2.44 0.9361
AT4G39720 VQ motif-containing protein (.... Potri.001G158800 4.47 0.8832
AT1G29290 unknown protein Potri.011G070500 5.00 0.9068
AT4G27290 S-locus lectin protein kinase ... Potri.001G411700 5.29 0.8884
AT5G26340 ATSTP13, MSS1, ... SUGAR TRANSPORT PROTEIN 13, Ma... Potri.010G089800 7.41 0.8780
AT3G06490 MYB BOS1, AtMYB108 BOTRYTIS-SUSCEPTIBLE1, myb dom... Potri.008G101400 7.54 0.8545 MYB108.2
AT3G48520 CYP94B3 cytochrome P450, family 94, su... Potri.005G220700 8.94 0.8870 Pt-CYP94.7

Potri.006G067300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.