Potri.006G067400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G20230 111 / 4e-31 SAG14, ATBCB SENESCENCE ASSOCIATED GENE 14, BLUE COPPER BINDING PROTEIN, blue-copper-binding protein (.1)
AT5G26330 93 / 4e-24 Cupredoxin superfamily protein (.1)
AT3G17675 82 / 1e-20 Cupredoxin superfamily protein (.1)
AT3G60270 82 / 4e-20 Cupredoxin superfamily protein (.1)
AT2G26720 83 / 5e-20 Cupredoxin superfamily protein (.1)
AT2G32300 83 / 1e-19 UCC1 uclacyanin 1 (.1)
AT3G60280 78 / 3e-18 UCC3 uclacyanin 3 (.1)
AT2G31050 77 / 9e-18 Cupredoxin superfamily protein (.1)
AT4G31840 76 / 2e-17 AtENODL15 early nodulin-like protein 15 (.1)
AT3G20570 75 / 4e-17 AtENODL9 early nodulin-like protein 9 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G129400 189 / 8e-62 AT5G20230 114 / 6e-32 SENESCENCE ASSOCIATED GENE 14, BLUE COPPER BINDING PROTEIN, blue-copper-binding protein (.1)
Potri.006G067300 115 / 4e-32 AT5G20230 97 / 2e-24 SENESCENCE ASSOCIATED GENE 14, BLUE COPPER BINDING PROTEIN, blue-copper-binding protein (.1)
Potri.018G129200 107 / 4e-29 AT2G32300 94 / 9e-23 uclacyanin 1 (.1)
Potri.001G192100 103 / 7e-28 AT5G20230 100 / 2e-26 SENESCENCE ASSOCIATED GENE 14, BLUE COPPER BINDING PROTEIN, blue-copper-binding protein (.1)
Potri.014G049600 96 / 4e-25 AT3G60270 111 / 8e-31 Cupredoxin superfamily protein (.1)
Potri.013G030450 95 / 5e-25 AT3G17675 106 / 2e-30 Cupredoxin superfamily protein (.1)
Potri.013G030000 93 / 2e-24 AT3G17675 106 / 2e-30 Cupredoxin superfamily protein (.1)
Potri.002G101300 91 / 2e-23 AT1G72230 131 / 6e-39 Cupredoxin superfamily protein (.1)
Potri.002G101200 90 / 2e-22 AT1G72230 129 / 2e-37 Cupredoxin superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035911 112 / 2e-31 AT5G20230 95 / 3e-24 SENESCENCE ASSOCIATED GENE 14, BLUE COPPER BINDING PROTEIN, blue-copper-binding protein (.1)
Lus10025752 112 / 2e-31 AT5G20230 101 / 1e-26 SENESCENCE ASSOCIATED GENE 14, BLUE COPPER BINDING PROTEIN, blue-copper-binding protein (.1)
Lus10006657 108 / 8e-29 AT1G45063 106 / 1e-26 copper ion binding;electron carriers (.1.2)
Lus10038098 107 / 2e-28 AT1G45063 107 / 1e-27 copper ion binding;electron carriers (.1.2)
Lus10019405 100 / 2e-25 AT1G45063 107 / 3e-27 copper ion binding;electron carriers (.1.2)
Lus10008720 96 / 3e-25 AT1G72230 140 / 2e-42 Cupredoxin superfamily protein (.1)
Lus10020944 90 / 7e-23 AT1G72230 141 / 1e-42 Cupredoxin superfamily protein (.1)
Lus10021925 84 / 1e-20 AT5G26330 170 / 5e-54 Cupredoxin superfamily protein (.1)
Lus10041211 83 / 3e-20 AT5G26330 167 / 6e-53 Cupredoxin superfamily protein (.1)
Lus10002614 81 / 6e-20 AT2G32300 100 / 1e-26 uclacyanin 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0026 CU_oxidase PF02298 Cu_bind_like Plastocyanin-like domain
Representative CDS sequence
>Potri.006G067400.1 pacid=42767221 polypeptide=Potri.006G067400.1.p locus=Potri.006G067400 ID=Potri.006G067400.1.v4.1 annot-version=v4.1
ATGAGAAGTCTCATTGTTTTTGTAGTTTTAGGAGCAGTATCACTATTGTTGCGTGGCTCAGAGGCAGTAGATCATGAGGTTGGAGACACCACCGGTTGGA
AAAGTCCTTCTAGCACCTCTTTCTACTCTGACTGGGCTTCAGGCAAAACCTTCGCTCTTGGTGACACTTTAAAATTCACATTCACTACAGGTGCACACGA
TGTGGCCACTGTCTCAAAGAGTGATTATGATAATTGCAACACAGGCAGTCAAAACAATCTTTTGACAACTGGACCAGCAACAATCACTCTCAATGTTACG
GGTGATATGTACTTTCTTTGCACAATTGCTGGCCACTGCTCCGCGGGACAAAAATTAGCCATTACCGTAGCTGCAGGCAACACCACCTCACCAGGGACAT
CACCGCCGCCACCCTCAGCCGCCTCAAGTCTTGTTGCTACCTTTGCTTTGATGTTCGTGTCCATTGCCATTAGTTTGATGTATTGCTTTTAG
AA sequence
>Potri.006G067400.1 pacid=42767221 polypeptide=Potri.006G067400.1.p locus=Potri.006G067400 ID=Potri.006G067400.1.v4.1 annot-version=v4.1
MRSLIVFVVLGAVSLLLRGSEAVDHEVGDTTGWKSPSSTSFYSDWASGKTFALGDTLKFTFTTGAHDVATVSKSDYDNCNTGSQNNLLTTGPATITLNVT
GDMYFLCTIAGHCSAGQKLAITVAAGNTTSPGTSPPPPSAASSLVATFALMFVSIAISLMYCF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G20230 SAG14, ATBCB SENESCENCE ASSOCIATED GENE 14,... Potri.006G067400 0 1
AT5G25220 HD KNAT3 KNOTTED1-like homeobox gene 3 ... Potri.006G190000 1.41 0.9501
AT5G53330 Ubiquitin-associated/translati... Potri.012G033300 4.24 0.9475
AT1G11050 Protein kinase superfamily pro... Potri.017G132800 4.47 0.9404
AT4G16330 2-oxoglutarate (2OG) and Fe(II... Potri.011G024100 4.69 0.9499
AT1G79230 STR1, ATRDH1, A... ARABIDOPSIS THALIANA RHODANESE... Potri.005G095300 6.00 0.9447 Pt-MST2.1
AT5G25220 HD KNAT3 KNOTTED1-like homeobox gene 3 ... Potri.018G114100 10.24 0.9280
AT1G69310 WRKY ATWRKY57, WRKY5... WRKY DNA-binding protein 57 (.... Potri.010G160100 10.95 0.9203
AT1G22360 ATUGT85A2, AT2 UDP-glucosyl transferase 85A2 ... Potri.017G052166 11.87 0.9183
AT5G41410 HD BEL1 BELL 1, POX (plant homeobox) f... Potri.001G100800 14.49 0.9370
Potri.015G023750 15.23 0.9250

Potri.006G067400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.