Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G01060 180 / 2e-55 GARP myb-like HTH transcriptional regulator family protein (.1.2) AT5G06800 161 / 2e-47 GARP myb-like HTH transcriptional regulator family protein (.1.2) AT5G29000 144 / 6e-41 GARP PHL1 PHR1-like 1, Homeodomain-like superfamily protein (.1.2.3.4) AT3G24120 139 / 1e-39 GARP Homeodomain-like superfamily protein (.1.2) AT4G28610 140 / 4e-39 GARP ATPHR1, PHR1 phosphate starvation response 1 (.1) AT3G04450 139 / 1e-38 GARP Homeodomain-like superfamily protein (.1.2) AT4G13640 135 / 3e-38 GARP UNE16 unfertilized embryo sac 16, Homeodomain-like superfamily protein (.1.2) AT1G79430 135 / 1e-37 GARP WDY, APL WOODY, ALTERED PHLOEM DEVELOPMENT, Homeodomain-like superfamily protein (.1.2) AT1G69580 134 / 1e-37 GARP Homeodomain-like superfamily protein (.1.2) AT3G13040 136 / 3e-37 GARP myb-like HTH transcriptional regulator family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G117000 [exp] 451 / 4e-163 AT2G01060 173 / 4e-53 myb-like HTH transcriptional regulator family protein (.1.2) Potri.006G000800 [exp] 186 / 3e-57 AT2G01060 321 / 1e-109 myb-like HTH transcriptional regulator family protein (.1.2) Potri.016G001100 [exp] 183 / 1e-56 AT2G01060 318 / 5e-109 myb-like HTH transcriptional regulator family protein (.1.2) Potri.006G191000 [exp] 152 / 9e-44 AT5G06800 252 / 2e-80 myb-like HTH transcriptional regulator family protein (.1.2) Potri.014G000700 [exp] 152 / 2e-43 AT3G13040 308 / 6e-101 myb-like HTH transcriptional regulator family protein (.1.2) Potri.019G020900 [exp] 148 / 9e-42 AT5G29000 306 / 4e-101 PHR1-like 1, Homeodomain-like superfamily protein (.1.2.3.4) Potri.007G003200 [exp] 148 / 2e-41 AT3G13040 330 / 1e-108 myb-like HTH transcriptional regulator family protein (.1.2) Potri.016G047900 [exp] 144 / 2e-40 AT5G06800 233 / 3e-73 myb-like HTH transcriptional regulator family protein (.1.2) Potri.002G257800 [exp] 144 / 1e-39 AT4G28610 332 / 6e-110 phosphate starvation response 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002483 [exp] 347 / 2e-121 AT2G01060 168 / 6e-51 myb-like HTH transcriptional regulator family protein (.1.2) Lus10004809 [exp] 345 / 6e-121 AT2G01060 171 / 5e-52 myb-like HTH transcriptional regulator family protein (.1.2) Lus10027806 [exp] 273 / 1e-92 AT2G01060 172 / 6e-53 myb-like HTH transcriptional regulator family protein (.1.2) Lus10005036 [exp] 272 / 3e-92 AT2G01060 175 / 4e-54 myb-like HTH transcriptional regulator family protein (.1.2) Lus10039124 [exp] 175 / 2e-53 AT2G01060 350 / 6e-122 myb-like HTH transcriptional regulator family protein (.1.2) Lus10038734 [exp] 160 / 4e-48 AT2G01060 324 / 1e-111 myb-like HTH transcriptional regulator family protein (.1.2) Lus10024938 [exp] 152 / 3e-43 AT4G28610 314 / 2e-103 phosphate starvation response 1 (.1) Lus10022886 [exp] 148 / 2e-41 AT4G28610 310 / 7e-102 phosphate starvation response 1 (.1) Lus10008197 [exp] 147 / 2e-41 AT5G29000 318 / 3e-105 PHR1-like 1, Homeodomain-like superfamily protein (.1.2.3.4) Lus10035705 [exp] 147 / 7e-41 AT3G13040 372 / 4e-125 myb-like HTH transcriptional regulator family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0123 [poplar] [flax] HTH PF00249 [poplar] [flax] Myb_DNA-binding Myb-like DNA-binding domain CL0123 [poplar] [flax] PF14379 [poplar] [flax] Myb_CC_LHEQLE MYB-CC type transfactor, LHEQLE motif
Representative CDS sequence Show only first row Show all	>Potri.006G101000.1 pacid=42770624 polypeptide=Potri.006G101000.1.p locus=Potri.006G101000 ID=Potri.006G101000.1.v4.1 annot-version=v4.1 ATGGGTTCAAGTCGCTCCGATGTATCCAACAAAGAAAGATTGCGCTGGACGCAAGAACTGCACGATCGGTTCGAGGAGGCTGTTAATCAACTTGGTGGTC CTGATAGAGCAACACCAAAGGGTATCTTGAGGGCTATGGGCATCTCTGGGTTGACTATCTACCATGTCAAGAGCCATTTACAGAAATACAGAATATCGAA GTTTATCCCAGAAACCAACAGAGGGAAGTATGAAAGGAGAAATATTTCAGAAATGTTGCCAAATTTCAGTGCGACATCTGGAGCTCAGCTCAATGAAGCA TTACTGATGCAAATGGAGGTTCAAAAGCGACTGAGCGATCAACTTGAGGTTCAAAAGAGCTTGAAGATTAAGATTGAAGCCCAAGGGAGATTCCTTGAGA GAATCGTGGAGGAAAACAGAAACCGAAGTGCGTCCATTAATCCAATCCCAAAACATAGCAAGTCTTTCTCTCCAGTATCACAGCCGTCTTTCTGTGATGA ATCAGAATCAAATGCTAGAGAATTTGAAACAGATTCGGAGGGTGAGAAAGCTGAAATACAGCCTGAAGAATACCTTCAAGCTCTTAAGAGATTGAGGACA GAAAACCATGCTTTACCTTCGCGGTATCAACTCCAACCTCTAAATCCTGATCCTTACAATCAAAACATGGTTCTTCAAAGAGATGCAAAATTTTCATATC CATCTCACGATGCCAACTTCCCATGGAACATTTTGGCCACCTGTCCATCACCTCTAGTGCCCAGTTTTTTCTAA
AA sequence Show only first row Show all	>Potri.006G101000.1 pacid=42770624 polypeptide=Potri.006G101000.1.p locus=Potri.006G101000 ID=Potri.006G101000.1.v4.1 annot-version=v4.1 MGSSRSDVSNKERLRWTQELHDRFEEAVNQLGGPDRATPKGILRAMGISGLTIYHVKSHLQKYRISKFIPETNRGKYERRNISEMLPNFSATSGAQLNEA LLMQMEVQKRLSDQLEVQKSLKIKIEAQGRFLERIVEENRNRSASINPIPKHSKSFSPVSQPSFCDESESNAREFETDSEGEKAEIQPEEYLQALKRLRT ENHALPSRYQLQPLNPDPYNQNMVLQRDAKFSYPSHDANFPWNILATCPSPLVPSFF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G01060	GARP		myb-like HTH transcriptional r...		Potri.006G101000 [exp]	0	1
AT1G56580		SVB	SMALLER WITH VARIABLE BRANCHES...		Potri.004G084600 [exp]	1.41	0.7997
AT4G07960		ATCSLC12	CELLULOSE-SYNTHASE LIKE C12, C...		Potri.005G146900 [exp]	6.55	0.8012
AT4G25810		XTH23, XTR6	xyloglucan endotransglucosylas...		Potri.013G005700 [exp]	9.59	0.7863	Pt-XTH3.1
					Potri.006G073450 [exp]	15.00	0.7790
					Potri.008G031400 [exp]	30.59	0.7361
AT2G35290			unknown protein		Potri.003G091400 [exp]	46.47	0.7391
AT4G37260	MYB	ATMYB73	myb domain protein 73 (.1)		Potri.014G035100 [exp]	50.61	0.7224
AT5G52020	AP2_ERF		Integrase-type DNA-binding sup...		Potri.001G110500 [exp]	66.82	0.6889	DREB65
AT3G24630			unknown protein		Potri.018G082300 [exp]	66.93	0.7498
AT4G23020			unknown protein		Potri.001G110900 [exp]	70.28	0.7238

Compare expression of checked genes

Potri.006G101000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.