Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G19210 174 / 1e-55 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT1G74930 156 / 2e-48 AP2_ERF ORA47, ERF018 Integrase-type DNA-binding superfamily protein (.1) AT5G21960 135 / 1e-39 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT4G31060 99 / 6e-26 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT1G21910 92 / 6e-23 AP2_ERF DREB26 dehydration response element-binding protein 26, Integrase-type DNA-binding superfamily protein (.1) AT4G06746 87 / 9e-22 AP2_ERF DEAR5, RAP2.9 DREB AND EAR MOTIF PROTEIN 5, related to AP2 9 (.1) AT1G22810 87 / 9e-22 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT5G67190 88 / 1e-21 AP2_ERF DEAR2 DREB and EAR motif protein 2 (.1) AT1G71520 86 / 1e-21 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT2G22200 88 / 3e-21 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G138800 [exp] 318 / 5e-112 AT1G19210 189 / 3e-61 Integrase-type DNA-binding superfamily protein (.1) Potri.006G218200 [exp] 168 / 8e-53 AT1G19210 176 / 4e-56 Integrase-type DNA-binding superfamily protein (.1) Potri.018G047300 [exp] 163 / 6e-51 AT1G19210 169 / 1e-53 Integrase-type DNA-binding superfamily protein (.1) Potri.018G038100 [exp] 107 / 2e-29 AT5G21960 100 / 5e-27 Integrase-type DNA-binding superfamily protein (.1) Potri.006G138900 [exp] 103 / 5e-28 AT5G21960 86 / 3e-21 Integrase-type DNA-binding superfamily protein (.1) Potri.006G080300 [exp] 94 / 3e-24 AT4G31060 143 / 1e-43 Integrase-type DNA-binding superfamily protein (.1) Potri.002G085600 [exp] 91 / 1e-22 AT1G77640 127 / 3e-36 Integrase-type DNA-binding superfamily protein (.1) Potri.005G168700 [exp] 89 / 7e-21 AT1G78080 197 / 3e-60 wound induced dedifferentiation 1, related to AP2 4 (.1) Potri.005G176000 [exp] 86 / 1e-20 AT1G21910 140 / 3e-41 dehydration response element-binding protein 26, Integrase-type DNA-binding superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033420 [exp] 168 / 1e-52 AT1G19210 181 / 4e-58 Integrase-type DNA-binding superfamily protein (.1) Lus10034885 [exp] 161 / 4e-50 AT1G19210 172 / 2e-54 Integrase-type DNA-binding superfamily protein (.1) Lus10038082 [exp] 134 / 3e-39 AT5G21960 155 / 3e-47 Integrase-type DNA-binding superfamily protein (.1) Lus10009798 [exp] 120 / 9e-35 AT1G19210 132 / 1e-39 Integrase-type DNA-binding superfamily protein (.1) Lus10009468 [exp] 90 / 4e-23 AT1G22810 132 / 1e-40 Integrase-type DNA-binding superfamily protein (.1) Lus10041044 [exp] 86 / 3e-21 AT1G71520 138 / 9e-43 Integrase-type DNA-binding superfamily protein (.1) Lus10009373 [exp] 86 / 6e-21 AT5G67190 164 / 3e-52 DREB and EAR motif protein 2 (.1) Lus10006179 [exp] 83 / 2e-20 AT1G71520 123 / 7e-37 Integrase-type DNA-binding superfamily protein (.1) Lus10010043 [exp] 83 / 6e-20 AT2G23340 170 / 1e-54 DREB and EAR motif protein 3 (.1) Lus10020913 [exp] 86 / 7e-20 AT1G78080 246 / 2e-79 wound induced dedifferentiation 1, related to AP2 4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0081 [poplar] [flax] MBD-like PF00847 [poplar] [flax] AP2 AP2 domain
Representative CDS sequence Show only first row Show all	>Potri.006G138700.1 pacid=42770150 polypeptide=Potri.006G138700.1.p locus=Potri.006G138700 ID=Potri.006G138700.1.v4.1 annot-version=v4.1 ATGGTGAAGTTCAATACAGAGAAGCCAGTTGCAGAGAGAAGTGACTCAAAATACAAGGGTGTTAGAAAAAGAAAATGGGGCCGGTGGGTGTCTGAAATCA GGCTACCGAATAGCCGGGAAAGAATTTGGTTAGGATCATATGATTCGGCTGAAAAAGCAGCACACGCTTTCGACGCAGCCCTTTTCTGCTTGCGCGGCAA CACAATGAAGTTTAATTTTTCGGAGAACCCTCCAAACATAGCAGGTGGCGGCTCACTTTCTCCCTCTGAGATTCAAGAAGCTGCCGCGAGGTTTGCCAAT TCGGAGCCCCAAAGAGGCCAATCCGGTAAGCTCGAGGCGGATCAATCCACATCTGTGTCCGAATCTCGACCGGAATCACCTTGTCTTTCGGCAGCATCAG ATGGTACTGTCCGAGACATGCCATTTTTTGATATGGCAATGAGTACAAGTTCGAGTAATCACCCCACAGAGTATGGGATATTTCCGGGTTTTGACGATCT TCACAGTGGTTTTTTTGCGCCATCATTTTTACCCAATCTTGATCATGGAGAGGGGTTCAATCTCGATGGTGTTTTGGAAGAAGATTCGTTTCTTTGGAAT TTCTAA
AA sequence Show only first row Show all	>Potri.006G138700.1 pacid=42770150 polypeptide=Potri.006G138700.1.p locus=Potri.006G138700 ID=Potri.006G138700.1.v4.1 annot-version=v4.1 MVKFNTEKPVAERSDSKYKGVRKRKWGRWVSEIRLPNSRERIWLGSYDSAEKAAHAFDAALFCLRGNTMKFNFSENPPNIAGGGSLSPSEIQEAAARFAN SEPQRGQSGKLEADQSTSVSESRPESPCLSAASDGTVRDMPFFDMAMSTSSSNHPTEYGIFPGFDDLHSGFFAPSFLPNLDHGEGFNLDGVLEEDSFLWN F

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G19210	AP2_ERF		Integrase-type DNA-binding sup...		Potri.006G138700 [exp]	0	1
AT5G22250		AtCAF1b	CCR4- associated factor 1b, Po...		Potri.004G200400 [exp]	2.44	0.9338
AT2G45360			Protein of unknown function (D...		Potri.003G115200 [exp]	3.00	0.9059
AT1G19210	AP2_ERF		Integrase-type DNA-binding sup...		Potri.006G138800 [exp]	3.16	0.9202	DREB47
AT5G51990	AP2_ERF	CBF4, DREB1D	DEHYDRATION-RESPONSIVE ELEMENT...		Potri.001G110700 [exp]	4.12	0.8507	DREB69,Pt-DREB1.6
AT3G03280			unknown protein		Potri.006G105500 [exp]	4.89	0.8974
AT1G19210	AP2_ERF		Integrase-type DNA-binding sup...		Potri.006G218200 [exp]	5.65	0.8209
AT3G46620			zinc finger (C3HC4-type RING f...		Potri.009G034800 [exp]	6.00	0.8786
AT3G03280			unknown protein		Potri.006G105600 [exp]	6.00	0.8904
AT4G17490	AP2_ERF	ERF-6-6, ATERF6	ethylene responsive element bi...		Potri.001G154200 [exp]	6.24	0.8580	Pt-ERF5.2,ERF4
AT4G20880			ethylene-responsive nuclear pr...		Potri.001G464300 [exp]	7.74	0.8626

Compare expression of checked genes

Potri.006G138700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.