Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G30220 81 / 7e-22 RUXF small nuclear ribonucleoprotein F (.1.2) AT2G14285 80 / 1e-21 Small nuclear ribonucleoprotein family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G092200 [exp] 84 / 6e-23 AT4G30220 155 / 2e-51 small nuclear ribonucleoprotein F (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037606 [exp] 81 / 8e-22 AT4G30220 173 / 2e-58 small nuclear ribonucleoprotein F (.1.2) Lus10006867 [exp] 80 / 1e-21 AT4G30220 119 / 4e-37 small nuclear ribonucleoprotein F (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0527 [poplar] [flax] Sm-like PF01423 [poplar] [flax] LSM LSM domain
Representative CDS sequence Show only first row Show all	>Potri.006G167000.7 pacid=42768273 polypeptide=Potri.006G167000.7.p locus=Potri.006G167000 ID=Potri.006G167000.7.v4.1 annot-version=v4.1 ATGCAAATGGGATACAAAGGTTTTCTTGCTTCTGTTGATTCATACATGAACCTCCTGGCACTGCCTTTCCTTTTCAATTTCCTGGGAAATACTGAAGAGT ATATCGATGGACAGTTCATTGGAAATTTGGGAGAGATTTTGATCAGGATCTGTTTGCAAGTTATCTGCAGACGCAACAATGTTCTCTACCTTCATGGAGT TCCGGAGGATGAAGAGATAGAAGATGCAGAACAAGACTAA
AA sequence Show only first row Show all	>Potri.006G167000.7 pacid=42768273 polypeptide=Potri.006G167000.7.p locus=Potri.006G167000 ID=Potri.006G167000.7.v4.1 annot-version=v4.1 MQMGYKGFLASVDSYMNLLALPFLFNFLGNTEEYIDGQFIGNLGEILIRICLQVICRRNNVLYLHGVPEDEEIEDAEQD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G14285			Small nuclear ribonucleoprotei...		Potri.006G167000 [exp]	0	1
AT4G01790			Ribosomal protein L7Ae/L30e/S1...		Potri.014G112200 [exp]	2.00	0.7434
AT1G20575		DPMS1	dolichol phosphate mannose syn...		Potri.002G010300 [exp]	3.16	0.7118
AT4G20280		TAF11	TBP-associated factor 11 (.1)		Potri.003G157450 [exp]	6.32	0.6943
AT1G49400		EMB1129	embryo defective 1129, Nucleic...		Potri.018G150100 [exp]	10.00	0.7031
AT3G59470	FAR1_related		Far-red impaired responsive (F...		Potri.017G029100 [exp]	10.95	0.6220
AT5G03415	E2F_DP	ATDPB, DPB	Transcription factor DP (.1.2)		Potri.016G093200 [exp]	11.22	0.6760
AT3G12680	C3HZnF	HUA1	ENHANCER OF AG-4 1, floral hom...		Potri.008G080300 [exp]	11.83	0.6756	Pt-HUA1.1
AT3G15750			Essential protein Yae1, N-term...		Potri.003G201500 [exp]	14.24	0.6180
AT5G22350		ELM1	ELONGATED MITOCHONDRIA 1, Prot...		Potri.016G075500 [exp]	14.73	0.6875
AT3G29090		PME31, ATPME31	A. THALIANA PECTIN METHYLESTER...		Potri.017G087300 [exp]	17.29	0.6249

Compare expression of checked genes

Potri.006G167000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.