Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G30330 166 / 3e-55 Small nuclear ribonucleoprotein family protein (.1) AT2G18740 165 / 3e-55 Small nuclear ribonucleoprotein family protein (.1.2) AT5G48870 49 / 3e-09 SAD1 SUPERSENSITIVE TO ABA AND DROUGHT 1, Small nuclear ribonucleoprotein family protein (.1) AT4G20440 41 / 2e-05 SMB small nuclear ribonucleoprotein associated protein B (.1.2.3.4) AT5G44500 39 / 8e-05 Small nuclear ribonucleoprotein family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G096200 [exp] 177 / 9e-60 AT4G30330 166 / 3e-55 Small nuclear ribonucleoprotein family protein (.1) Potri.001G277900 [exp] 52 / 2e-10 AT5G48870 162 / 5e-54 SUPERSENSITIVE TO ABA AND DROUGHT 1, Small nuclear ribonucleoprotein family protein (.1) Potri.009G072500 [exp] 52 / 2e-10 AT5G48870 162 / 5e-54 SUPERSENSITIVE TO ABA AND DROUGHT 1, Small nuclear ribonucleoprotein family protein (.1) Potri.011G155700 [exp] 42 / 9e-06 AT4G20440 218 / 2e-70 small nuclear ribonucleoprotein associated protein B (.1.2.3.4) Potri.001G440100 [exp] 42 / 9e-06 AT4G20440 211 / 2e-67 small nuclear ribonucleoprotein associated protein B (.1.2.3.4)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018034 [exp] 147 / 6e-45 AT4G20990 248 / 1e-81 A. THALIANA ALPHA CARBONIC ANHYDRASE 4, alpha carbonic anhydrase 4 (.1) Lus10042030 [exp] 147 / 6e-45 AT4G20990 313 / 9e-107 A. THALIANA ALPHA CARBONIC ANHYDRASE 4, alpha carbonic anhydrase 4 (.1) Lus10011877 [exp] 51 / 2e-09 AT5G48870 169 / 8e-56 SUPERSENSITIVE TO ABA AND DROUGHT 1, Small nuclear ribonucleoprotein family protein (.1) Lus10022810 [exp] 50 / 2e-09 AT5G48870 167 / 8e-56 SUPERSENSITIVE TO ABA AND DROUGHT 1, Small nuclear ribonucleoprotein family protein (.1) Lus10013108 [exp] 39 / 0.0001 AT5G44500 269 / 5e-91 Small nuclear ribonucleoprotein family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0527 [poplar] [flax] Sm-like PF01423 [poplar] [flax] LSM LSM domain
Representative CDS sequence Show only first row Show all	>Potri.006G174000.1 pacid=42769827 polypeptide=Potri.006G174000.1.p locus=Potri.006G174000 ID=Potri.006G174000.1.v4.1 annot-version=v4.1 ATGGCGAGCACCAAAGTCCAGCGTATTATGACCCAACCCATTAACTTGATTTTCAGGTTTCTTCAAAGTAAAGCTCGCATTCAGATTTGGCTTTTTGAGC AGAAGGATTTGAGAATTGAAGGCCGAATTATTGGCTTTGATGAATACATGAATTTGGTTTTGGAGGATGCTGAGGAAGTCAATATCAAGAAGAAGAGCAG AAAGTCTTTGGGAAGGATTCTTCTTAAGGGAGACAATATAACTCTGATGATGAACACGGGAAAGTAA
AA sequence Show only first row Show all	>Potri.006G174000.1 pacid=42769827 polypeptide=Potri.006G174000.1.p locus=Potri.006G174000 ID=Potri.006G174000.1.v4.1 annot-version=v4.1 MASTKVQRIMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLEDAEEVNIKKKSRKSLGRILLKGDNITLMMNTGK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G30330			Small nuclear ribonucleoprotei...		Potri.006G174000 [exp]	0	1
AT2G18400			ribosomal protein L6 family pr...		Potri.007G024900 [exp]	2.64	0.8239
AT3G13230			RNA-binding KH domain-containi...		Potri.011G166000 [exp]	4.89	0.8107
AT5G55140			ribosomal protein L30 family p...		Potri.002G225600 [exp]	6.16	0.8168
AT1G57540			unknown protein		Potri.005G002900 [exp]	6.48	0.8160
AT2G20490		NOP10, EDA27	EMBRYO SAC DEVELOPMENT ARREST ...		Potri.002G036500 [exp]	7.93	0.7868
AT2G35605			SWIB/MDM2 domain superfamily p...		Potri.005G078400 [exp]	8.48	0.7952
AT1G06010			unknown protein		Potri.012G134200 [exp]	9.48	0.7550
AT2G27960		CKS1AT, CKS1	cyclin-dependent kinase-subuni...		Potri.009G004000 [exp]	9.74	0.7418
AT3G59650			mitochondrial ribosomal protei...		Potri.013G126200 [exp]	11.18	0.7972
AT1G08580			unknown protein		Potri.019G049300 [exp]	12.72	0.7696

Compare expression of checked genes

Potri.006G174000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.