Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G11500 153 / 1e-50 Small nuclear ribonucleoprotein family protein (.1) AT2G23930 150 / 2e-49 SNRNP-G probable small nuclear ribonucleoprotein G (.1.2) AT2G03870 58 / 1e-12 EMB2816 EMBRYO DEFECTIVE 2816, Small nuclear ribonucleoprotein family protein (.1.2) AT3G14080 53 / 2e-10 Small nuclear ribonucleoprotein family protein (.1.2) AT1G19120 50 / 2e-09 Small nuclear ribonucleoprotein family protein (.1) AT5G44500 39 / 0.0001 Small nuclear ribonucleoprotein family protein (.1.2) AT3G59810 37 / 0.0002 Small nuclear ribonucleoprotein family protein (.1) AT1G65700 37 / 0.0002 Small nuclear ribonucleoprotein family protein (.1.2.3) AT4G30330 36 / 0.0004 Small nuclear ribonucleoprotein family protein (.1) AT4G20440 37 / 0.0005 SMB small nuclear ribonucleoprotein associated protein B (.1.2.3.4)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G078100 [exp] 155 / 1e-51 AT3G11500 152 / 5e-50 Small nuclear ribonucleoprotein family protein (.1) Potri.001G269500 [exp] 58 / 1e-12 AT2G03870 183 / 8e-62 EMBRYO DEFECTIVE 2816, Small nuclear ribonucleoprotein family protein (.1.2) Potri.009G064000 [exp] 58 / 1e-12 AT2G03870 183 / 8e-62 EMBRYO DEFECTIVE 2816, Small nuclear ribonucleoprotein family protein (.1.2) Potri.003G068400 [exp] 52 / 5e-10 AT3G14080 234 / 3e-81 Small nuclear ribonucleoprotein family protein (.1.2) Potri.001G166600 [exp] 51 / 9e-10 AT3G14080 233 / 9e-81 Small nuclear ribonucleoprotein family protein (.1.2) Potri.011G155700 [exp] 41 / 2e-05 AT4G20440 218 / 2e-70 small nuclear ribonucleoprotein associated protein B (.1.2.3.4) Potri.001G440100 [exp] 41 / 2e-05 AT4G20440 211 / 2e-67 small nuclear ribonucleoprotein associated protein B (.1.2.3.4) Potri.001G278000 [exp] 39 / 3e-05 AT1G65700 146 / 3e-47 Small nuclear ribonucleoprotein family protein (.1.2.3) Potri.001G277900 [exp] 36 / 0.0003 AT5G48870 162 / 5e-54 SUPERSENSITIVE TO ABA AND DROUGHT 1, Small nuclear ribonucleoprotein family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017019 [exp] 154 / 1e-50 AT3G11500 150 / 2e-49 Small nuclear ribonucleoprotein family protein (.1) Lus10021342 [exp] 153 / 2e-50 AT3G11500 152 / 3e-50 Small nuclear ribonucleoprotein family protein (.1) Lus10035639 [exp] 57 / 5e-12 AT2G03870 179 / 3e-60 EMBRYO DEFECTIVE 2816, Small nuclear ribonucleoprotein family protein (.1.2) Lus10008124 [exp] 52 / 7e-10 AT3G14080 236 / 3e-82 Small nuclear ribonucleoprotein family protein (.1.2) Lus10013108 [exp] 41 / 2e-05 AT5G44500 269 / 5e-91 Small nuclear ribonucleoprotein family protein (.1.2) Lus10011877 [exp] 38 / 0.0001 AT5G48870 169 / 8e-56 SUPERSENSITIVE TO ABA AND DROUGHT 1, Small nuclear ribonucleoprotein family protein (.1) Lus10042884 [exp] 37 / 0.0002 AT1G65700 158 / 7e-52 Small nuclear ribonucleoprotein family protein (.1.2.3) Lus10022810 [exp] 36 / 0.0003 AT5G48870 167 / 8e-56 SUPERSENSITIVE TO ABA AND DROUGHT 1, Small nuclear ribonucleoprotein family protein (.1) Lus10023386 [exp] 37 / 0.0005 AT5G44500 259 / 5e-87 Small nuclear ribonucleoprotein family protein (.1.2) Lus10042030 [exp] 37 / 0.0006 AT4G20990 313 / 9e-107 A. THALIANA ALPHA CARBONIC ANHYDRASE 4, alpha carbonic anhydrase 4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0527 [poplar] [flax] Sm-like PF01423 [poplar] [flax] LSM LSM domain
Representative CDS sequence Show only first row Show all	>Potri.006G211100.1 pacid=42766900 polypeptide=Potri.006G211100.1.p locus=Potri.006G211100 ID=Potri.006G211100.1.v4.1 annot-version=v4.1 ATGAGCCGATCGGGTCAGCCACCAGATCTCAAGAAGTATATGGACAAGAAGCTTCAAATCAAGCTGAATGCAAATAGGATGGTGGTTGGAACACTTCGTG GGTTTGACCAGTTCATGAATTTAGTTGTTGACAACACTGTGGAGGTGAATGGTGATGAGAAAACTGATATAGGCATGGTGGTGCTCAGAGGCAATAGTGT TGTCACAGTTGAAGCATTGGAACCTGTAAACAGAGCACAGTGA
AA sequence Show only first row Show all	>Potri.006G211100.1 pacid=42766900 polypeptide=Potri.006G211100.1.p locus=Potri.006G211100 ID=Potri.006G211100.1.v4.1 annot-version=v4.1 MSRSGQPPDLKKYMDKKLQIKLNANRMVVGTLRGFDQFMNLVVDNTVEVNGDEKTDIGMVVLRGNSVVTVEALEPVNRAQ

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G11500			Small nuclear ribonucleoprotei...		Potri.006G211100 [exp]	0	1
AT5G54580			RNA-binding (RRM/RBD/RNP motif...		Potri.001G409800 [exp]	1.41	0.9180
AT5G53070			Ribosomal protein L9/RNase H1 ...		Potri.012G017300 [exp]	1.41	0.9132
AT1G14990			unknown protein		Potri.008G129900 [exp]	1.73	0.9128
AT4G26055			unknown protein		Potri.010G204200 [exp]	2.00	0.8994
AT3G52230			unknown protein		Potri.010G233400 [exp]	4.89	0.8850
AT5G62290			nucleotide-sensitive chloride ...		Potri.012G128500 [exp]	7.74	0.8879
AT1G14990			unknown protein		Potri.010G112300 [exp]	8.36	0.8860
AT3G59840			unknown protein		Potri.001G146700 [exp]	10.19	0.8742
AT5G30495			Fcf2 pre-rRNA processing prote...		Potri.008G206400 [exp]	13.41	0.8317
AT1G02370			Tetratricopeptide repeat (TPR)...		Potri.002G194400 [exp]	16.24	0.8591

Compare expression of checked genes

Potri.006G211100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.