Potri.006G235901 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G10010 103 / 1e-27 AAP8, ATAAP8 amino acid permease 8 (.1)
AT1G58360 102 / 3e-27 NAT2, AAP1 NEUTRAL AMINO ACID TRANSPORTER 2, amino acid permease 1 (.1)
AT5G49630 98 / 2e-25 AAP6 amino acid permease 6 (.1)
AT1G77380 98 / 2e-25 AAP3, ATAAP3 amino acid permease 3 (.1)
AT5G63850 98 / 2e-25 AAP4 amino acid permease 4 (.1)
AT5G09220 96 / 1e-24 AAP2 amino acid permease 2 (.1)
AT1G44100 90 / 2e-22 AAP5 amino acid permease 5 (.1)
AT5G23810 86 / 3e-21 AAP7 amino acid permease 7 (.1.2)
AT3G01760 45 / 1e-06 Transmembrane amino acid transporter family protein (.1)
AT5G40780 44 / 2e-06 LHT1, LTH1 lysine histidine transporter 1 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G100100 99 / 7e-26 AT5G09220 768 / 0.0 amino acid permease 2 (.1)
Potri.005G068900 99 / 1e-25 AT5G09220 799 / 0.0 amino acid permease 2 (.1)
Potri.002G079700 97 / 4e-25 AT1G77380 756 / 0.0 amino acid permease 3 (.1)
Potri.002G080066 96 / 1e-24 AT1G77380 751 / 0.0 amino acid permease 3 (.1)
Potri.005G181500 95 / 3e-24 AT1G77380 728 / 0.0 amino acid permease 3 (.1)
Potri.002G079400 95 / 3e-24 AT1G77380 765 / 0.0 amino acid permease 3 (.1)
Potri.005G181600 93 / 2e-23 AT1G77380 746 / 0.0 amino acid permease 3 (.1)
Potri.002G079500 92 / 3e-23 AT1G77380 766 / 0.0 amino acid permease 3 (.1)
Potri.009G085000 92 / 3e-23 AT1G58360 546 / 0.0 NEUTRAL AMINO ACID TRANSPORTER 2, amino acid permease 1 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042741 99 / 1e-25 AT1G77380 515 / 0.0 amino acid permease 3 (.1)
Lus10029707 98 / 2e-25 AT1G77380 759 / 0.0 amino acid permease 3 (.1)
Lus10029703 98 / 3e-25 AT1G44100 688 / 0.0 amino acid permease 5 (.1)
Lus10018852 96 / 2e-24 AT1G77380 702 / 0.0 amino acid permease 3 (.1)
Lus10036777 95 / 3e-24 AT1G77380 684 / 0.0 amino acid permease 3 (.1)
Lus10042740 94 / 5e-24 AT1G77380 698 / 0.0 amino acid permease 3 (.1)
Lus10037150 94 / 5e-24 AT1G77380 680 / 0.0 amino acid permease 3 (.1)
Lus10007235 94 / 5e-24 AT5G49630 720 / 0.0 amino acid permease 6 (.1)
Lus10029702 94 / 7e-24 AT1G77380 706 / 0.0 amino acid permease 3 (.1)
Lus10012444 93 / 1e-23 AT1G10010 535 / 0.0 amino acid permease 8 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0062 APC PF01490 Aa_trans Transmembrane amino acid transporter protein
Representative CDS sequence
>Potri.006G235901.1 pacid=42770112 polypeptide=Potri.006G235901.1.p locus=Potri.006G235901 ID=Potri.006G235901.1.v4.1 annot-version=v4.1
ATGCAGTGTGTGAATCTGGTTCCGATCCTCGCACCATTTCAGACGGGGAGGTGGATGATGATGGCAAACCAAGAAGAAACAGGGATAATGTGGACGGCAA
GTGCCCATATAATAACAACAATTATAGGCTCCGGGGTTCTCTCACTAGCCTGGGGCATGGCCCAGCTTGGATGGATTGCTGGCATAGGCATTCTCTTAAC
CTTTTCAGTCATTACATATTACACCTCTAGTCTCTTGGCAGATTGTTATAGATTTCCAAAGCCTATATCTGGCAAGTGA
AA sequence
>Potri.006G235901.1 pacid=42770112 polypeptide=Potri.006G235901.1.p locus=Potri.006G235901 ID=Potri.006G235901.1.v4.1 annot-version=v4.1
MQCVNLVPILAPFQTGRWMMMANQEETGIMWTASAHIITTIIGSGVLSLAWGMAQLGWIAGIGILLTFSVITYYTSSLLADCYRFPKPISGK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G10010 AAP8, ATAAP8 amino acid permease 8 (.1) Potri.006G235901 0 1
AT4G21200 ATGA2OX8 ARABIDOPSIS THALIANA GIBBERELL... Potri.011G134100 4.47 0.9106
Potri.018G131900 8.83 0.9324
AT2G33560 BUBR1 BUB1-related (BUB1: budding un... Potri.002G002900 13.22 0.9302
AT5G25160 C2H2ZnF ZFP3 zinc finger protein 3 (.1) Potri.018G123800 13.67 0.8891
AT1G58110 bZIP Basic-leucine zipper (bZIP) tr... Potri.015G147800 17.02 0.8785
AT2G37030 SAUR-like auxin-responsive pro... Potri.008G037900 18.73 0.8814 SAUR40
AT1G10010 AAP8, ATAAP8 amino acid permease 8 (.1) Potri.006G236000 22.24 0.9058
AT5G12980 Cell differentiation, Rcd1-lik... Potri.014G155500 23.49 0.8855
AT5G64260 EXL2, MSJ1.10 EXORDIUM like 2 (.1) Potri.014G126000 24.79 0.8143
AT1G80760 NLM7, NIP6;1 NOD26-like intrinsic protein 6... Potri.003G180900 26.98 0.8974 Pt-NIP6.2

Potri.006G235901 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.