Potri.006G236100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G77380 107 / 1e-27 AAP3, ATAAP3 amino acid permease 3 (.1)
AT5G49630 106 / 2e-27 AAP6 amino acid permease 6 (.1)
AT1G44100 102 / 1e-25 AAP5 amino acid permease 5 (.1)
AT5G63850 100 / 3e-25 AAP4 amino acid permease 4 (.1)
AT1G58360 100 / 4e-25 NAT2, AAP1 NEUTRAL AMINO ACID TRANSPORTER 2, amino acid permease 1 (.1)
AT5G09220 96 / 2e-23 AAP2 amino acid permease 2 (.1)
AT1G10010 93 / 1e-22 AAP8, ATAAP8 amino acid permease 8 (.1)
AT5G23810 74 / 1e-15 AAP7 amino acid permease 7 (.1.2)
AT5G41800 39 / 0.001 Transmembrane amino acid transporter family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G236000 125 / 2e-34 AT1G10010 580 / 0.0 amino acid permease 8 (.1)
Potri.002G112100 111 / 5e-29 AT5G49630 691 / 0.0 amino acid permease 6 (.1)
Potri.005G068900 106 / 3e-27 AT5G09220 799 / 0.0 amino acid permease 2 (.1)
Potri.007G100100 105 / 4e-27 AT5G09220 768 / 0.0 amino acid permease 2 (.1)
Potri.009G133600 105 / 5e-27 AT5G09220 711 / 0.0 amino acid permease 2 (.1)
Potri.002G079500 101 / 2e-25 AT1G77380 766 / 0.0 amino acid permease 3 (.1)
Potri.002G079400 101 / 2e-25 AT1G77380 765 / 0.0 amino acid permease 3 (.1)
Potri.002G079700 100 / 3e-25 AT1G77380 756 / 0.0 amino acid permease 3 (.1)
Potri.002G080066 99 / 1e-24 AT1G77380 751 / 0.0 amino acid permease 3 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028236 105 / 1e-26 AT5G49630 687 / 0.0 amino acid permease 6 (.1)
Lus10007235 102 / 8e-26 AT5G49630 720 / 0.0 amino acid permease 6 (.1)
Lus10029707 100 / 5e-25 AT1G77380 759 / 0.0 amino acid permease 3 (.1)
Lus10018852 99 / 1e-24 AT1G77380 702 / 0.0 amino acid permease 3 (.1)
Lus10042744 99 / 1e-24 AT1G77380 667 / 0.0 amino acid permease 3 (.1)
Lus10028546 98 / 2e-24 AT1G77380 552 / 0.0 amino acid permease 3 (.1)
Lus10035663 97 / 5e-24 AT1G10010 569 / 0.0 amino acid permease 8 (.1)
Lus10029703 97 / 7e-24 AT1G44100 688 / 0.0 amino acid permease 5 (.1)
Lus10037248 95 / 3e-23 AT1G10010 563 / 0.0 amino acid permease 8 (.1)
Lus10012443 93 / 6e-23 AT1G10010 150 / 1e-41 amino acid permease 8 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0062 APC PF01490 Aa_trans Transmembrane amino acid transporter protein
Representative CDS sequence
>Potri.006G236100.2 pacid=42769661 polypeptide=Potri.006G236100.2.p locus=Potri.006G236100 ID=Potri.006G236100.2.v4.1 annot-version=v4.1
ATGGGGTCTTCTTCACAGGACTTCAAATTTCTAAATAATTACAAGCAATTGAAGTCAAAATATCGTCCCAGGTTACCACTTGCTAAGGTATTATCCCAAC
CAGTTTTCGGTGCATTAGAGACCTGGGCTAGCCTGGTGTGGCCTGATTCAAAGTTTGCAACCATCGAGCATTCAATAAGGATAGGGAAATACATAAATTT
TAGGGGGAACTTGCTAAGACTAATATGGAGAACAGTATATGTGGTGGTGGTAACTGTGCTTGCCATGGCATTCCCCTTCTTCAACGACGTCCTTGCACTC
CTTGGAGCCGTTGGGTATTGGCCAATGACAGTATATTTTCCTGTGGAGATGTACATTGCTCAAAAGAAGATTCAACGGGGATCAGTCAAGTGGTTTGTTC
TCCAGCTTTTGAACTTGGTGTGCTTACTGGTTGCCATAGCTGCGGCATGTGGTGCCATTGAAGGATTGAATCATGCTCTTCAAAACTCTAAGCCCTTCAA
GTTTTAA
AA sequence
>Potri.006G236100.2 pacid=42769661 polypeptide=Potri.006G236100.2.p locus=Potri.006G236100 ID=Potri.006G236100.2.v4.1 annot-version=v4.1
MGSSSQDFKFLNNYKQLKSKYRPRLPLAKVLSQPVFGALETWASLVWPDSKFATIEHSIRIGKYINFRGNLLRLIWRTVYVVVVTVLAMAFPFFNDVLAL
LGAVGYWPMTVYFPVEMYIAQKKIQRGSVKWFVLQLLNLVCLLVAIAAACGAIEGLNHALQNSKPFKF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G49630 AAP6 amino acid permease 6 (.1) Potri.006G236100 0 1
AT1G66920 Protein kinase superfamily pro... Potri.012G003301 7.74 0.9042
AT3G19920 unknown protein Potri.007G073600 8.00 1.0000
Potri.006G017750 8.12 0.9556
Potri.008G053150 9.00 1.0000
AT3G51020 unknown protein Potri.002G011500 11.31 0.8968
AT2G14760 bHLH bHLH084 basic helix-loop-helix (bHLH) ... Potri.014G017100 11.40 0.8667
AT5G20045 unknown protein Potri.008G015800 14.49 0.8268
AT1G24020 MLP423 MLP-like protein 423 (.1.2) Potri.011G026100 15.87 0.9197
Potri.003G109601 17.32 0.8437
AT1G24020 MLP423 MLP-like protein 423 (.1.2) Potri.011G025966 20.39 0.9085

Potri.006G236100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.