Potri.006G259101 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G26330 142 / 3e-43 Cupredoxin superfamily protein (.1)
AT2G31050 119 / 5e-34 Cupredoxin superfamily protein (.1)
AT2G26720 118 / 9e-34 Cupredoxin superfamily protein (.1)
AT2G32300 102 / 6e-27 UCC1 uclacyanin 1 (.1)
AT4G31840 93 / 4e-24 AtENODL15 early nodulin-like protein 15 (.1)
AT2G25060 91 / 4e-23 AtENODL14 early nodulin-like protein 14 (.1)
AT5G53870 88 / 5e-21 AtENODL1 early nodulin-like protein 1 (.1)
AT4G30590 85 / 6e-21 AtENODL12 early nodulin-like protein 12 (.1)
AT1G45063 87 / 7e-21 copper ion binding;electron carriers (.1.2)
AT5G25090 84 / 1e-20 AtENODL13 early nodulin-like protein 13 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G259000 290 / 6e-102 AT5G26330 144 / 6e-44 Cupredoxin superfamily protein (.1)
Potri.002G161300 238 / 1e-81 AT5G26330 146 / 5e-45 Cupredoxin superfamily protein (.1)
Potri.002G156401 216 / 7e-73 AT5G26330 138 / 1e-41 Cupredoxin superfamily protein (.1)
Potri.002G156100 216 / 7e-73 AT5G26330 138 / 1e-41 Cupredoxin superfamily protein (.1)
Potri.001G268700 216 / 8e-73 AT5G26330 138 / 6e-42 Cupredoxin superfamily protein (.1)
Potri.002G052500 183 / 1e-59 AT5G26330 130 / 9e-39 Cupredoxin superfamily protein (.1)
Potri.004G171100 155 / 5e-49 AT5G26330 92 / 9e-24 Cupredoxin superfamily protein (.1)
Potri.010G089900 144 / 3e-44 AT5G26330 187 / 7e-61 Cupredoxin superfamily protein (.1)
Potri.008G151000 140 / 8e-43 AT5G26330 183 / 2e-59 Cupredoxin superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010533 143 / 7e-44 AT5G26330 174 / 1e-55 Cupredoxin superfamily protein (.1)
Lus10021925 130 / 1e-38 AT5G26330 170 / 5e-54 Cupredoxin superfamily protein (.1)
Lus10041211 129 / 3e-38 AT5G26330 167 / 6e-53 Cupredoxin superfamily protein (.1)
Lus10002451 109 / 3e-30 AT5G26330 136 / 2e-40 Cupredoxin superfamily protein (.1)
Lus10027143 102 / 5e-27 AT2G32300 137 / 9e-40 uclacyanin 1 (.1)
Lus10006682 97 / 7e-26 AT2G32300 95 / 1e-24 uclacyanin 1 (.1)
Lus10007027 97 / 9e-26 AT5G26330 100 / 5e-27 Cupredoxin superfamily protein (.1)
Lus10007025 95 / 8e-25 AT2G32300 101 / 3e-27 uclacyanin 1 (.1)
Lus10007026 93 / 4e-24 AT2G32300 96 / 4e-25 uclacyanin 1 (.1)
Lus10008720 93 / 7e-24 AT1G72230 140 / 2e-42 Cupredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0026 CU_oxidase PF02298 Cu_bind_like Plastocyanin-like domain
Representative CDS sequence
>Potri.006G259101.1 pacid=42768089 polypeptide=Potri.006G259101.1.p locus=Potri.006G259101 ID=Potri.006G259101.1.v4.1 annot-version=v4.1
ATGGCTTTCGATAAAAGCATGGTGATTTTCTTTCTAATTTTCATGGCCTTTTTTAGAGGAGTTTCCATGGCTGCTGTTTACCAAGTCGGTGACTCTGCTG
GTTGGACAAGCATGGGTCAGGTTGACTACCAAGAATGGGCTGCCAGCAAGAATTTTCACGTCGGTGATACTCTCGTTTTCAATTACAACAACCAATTCCA
CAACGTGAAGCAAGCTACACAACAGGGTTTCGAGGCATGCAATGCTACGTCCCCAATAGCTACTTACACCAACGGCTACGATACAGTCACTCTTGAAAAG
CTTGGCCACTTTTACTTCATATGCGGCTACCCTGGTCACTGCCAAGCAGGACAAAAGATCGATATCCTGGTTTCTTCACCCACTTCAAGTTTGAGCCCTG
CTCCATCAACTCAGACTTCAGAGCCTAGCGTTGCTTCATCTCTTTATTTTAGGTATAATCTGTCTTGGATTTTGGGTGTGCTCCTAGCTTTCTGTCTCTC
AGGATTTGCTTATTAG
AA sequence
>Potri.006G259101.1 pacid=42768089 polypeptide=Potri.006G259101.1.p locus=Potri.006G259101 ID=Potri.006G259101.1.v4.1 annot-version=v4.1
MAFDKSMVIFFLIFMAFFRGVSMAAVYQVGDSAGWTSMGQVDYQEWAASKNFHVGDTLVFNYNNQFHNVKQATQQGFEACNATSPIATYTNGYDTVTLEK
LGHFYFICGYPGHCQAGQKIDILVSSPTSSLSPAPSTQTSEPSVASSLYFRYNLSWILGVLLAFCLSGFAY

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G26330 Cupredoxin superfamily protein... Potri.006G259101 0 1
AT3G47570 Leucine-rich repeat protein ki... Potri.012G044500 2.00 0.6890
AT3G55620 eIF6A, EMB1624 embryo defective 1624, eukaryo... Potri.005G098700 55.96 0.5226
Potri.013G066680 58.80 0.5511
AT3G56500 serine-rich protein-related (.... Potri.002G250700 83.78 0.4927

Potri.006G259101 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.