Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	PPLZ02.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G25190 169 / 1e-53 AP2_ERF ESE3 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) AT1G15360 90 / 2e-22 AP2_ERF WIN1, SHN1 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) AT5G25390 82 / 1e-19 AP2_ERF SHN3, SHN2 shine3, Integrase-type DNA-binding superfamily protein (.1.2) AT5G11190 81 / 3e-19 AP2_ERF SHN2, SHN3 shine2, Integrase-type DNA-binding superfamily protein (.1) AT1G22190 73 / 1e-15 AP2_ERF RAP2.4 related to AP2 4, Integrase-type DNA-binding superfamily protein (.1) AT1G36060 72 / 6e-15 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT1G78080 71 / 2e-14 AP2_ERF CAF1, RAP2.4, WIND1 wound induced dedifferentiation 1, related to AP2 4 (.1) AT4G13620 71 / 3e-14 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT4G39780 69 / 3e-14 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT2G22200 69 / 5e-14 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G021900 [exp] 298 / 3e-104 AT5G25190 169 / 1e-53 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Potri.001G048200 [exp] 182 / 1e-58 AT5G25190 162 / 5e-51 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Potri.003G179900 [exp] 118 / 2e-33 AT5G25190 100 / 1e-26 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Potri.018G131400 [exp] 86 / 5e-21 AT1G15360 194 / 6e-63 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Potri.003G033000 [exp] 85 / 1e-20 AT1G15360 181 / 3e-58 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Potri.006G069400 [exp] 84 / 4e-20 AT1G15360 186 / 9e-60 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Potri.018G028000 [exp] 81 / 2e-19 AT5G11190 204 / 8e-68 shine2, Integrase-type DNA-binding superfamily protein (.1) Potri.006G253800 [exp] 81 / 5e-19 AT5G11190 197 / 1e-64 shine2, Integrase-type DNA-binding superfamily protein (.1) Potri.005G077300 [exp] 74 / 2e-15 AT1G78080 207 / 7e-64 wound induced dedifferentiation 1, related to AP2 4 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041023 [exp] 168 / 4e-53 AT5G25190 205 / 7e-68 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Lus10016815 [exp] 165 / 4e-52 AT5G25190 206 / 1e-68 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Lus10035859 [exp] 159 / 8e-50 AT5G25190 196 / 9e-65 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Lus10005343 [exp] 124 / 1e-36 AT5G25190 174 / 3e-56 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Lus10041614 [exp] 97 / 8e-25 AT5G25190 165 / 1e-51 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Lus10005716 [exp] 87 / 4e-21 AT1G15360 236 / 3e-79 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10009480 [exp] 86 / 6e-21 AT1G15360 207 / 1e-68 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10030097 [exp] 86 / 7e-21 AT1G15360 234 / 1e-78 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10019414 [exp] 85 / 4e-20 AT1G15360 207 / 1e-67 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10002015 [exp] 79 / 4e-18 AT1G15360 183 / 4e-59 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0081 [poplar] [flax] MBD-like PF00847 [poplar] [flax] AP2 AP2 domain
Representative CDS sequence Show only first row Show all	>Potri.006G261200.1 pacid=42767975 polypeptide=Potri.006G261200.1.p locus=Potri.006G261200 ID=Potri.006G261200.1.v4.1 annot-version=v4.1 ATGGCCAGACCACAGCAGCGATACCGAGGGGTCCGACAAAGGCATTGGGGATCATGGGTGTCTGAGATTCGTCATCCTTTATTGAAGACTAGAATTTGGC TAGGCACGTTTGAAACAGCAGAGGATGCAGCAAGAGCTTATGATGAAGCTGCAAGGCTTATGTGTGGACCTAGGGCTAGGACCAACTTCCCTTATAACCC AAATGCATCACAATCAGCTTCATCGAAACTTCTCTCCGCAACTTTGACAGCAAAGTTGCACAGGTGCTATATGGCCTCATTGCAAGTGACCAAAAAAACA TCACTTCATGAACAAAAACAACAGCAACAAAAGGCACCAACTTCACTTGCCAACACCCCCACCAATGGCATTGTCATAAAAAGTGAGGAACTTGATGCTT TATTGCCAGAGAAAAGCCCATTACAAGTTCAAGAGGCAGAGGCAAACTGGGTGTACAAGAAAGTTCAAGTTGATAACAACAACCAGCAATTCATAAAGCC TCTTGAAGATCACCACATTGAGCAAATGATTGAAGAGTTGCTTGACTATGGGTCTATCGAGTTTTTCTCTGGGGTAACAACTCAGTAA
AA sequence Show only first row Show all	>Potri.006G261200.1 pacid=42767975 polypeptide=Potri.006G261200.1.p locus=Potri.006G261200 ID=Potri.006G261200.1.v4.1 annot-version=v4.1 MARPQQRYRGVRQRHWGSWVSEIRHPLLKTRIWLGTFETAEDAARAYDEAARLMCGPRARTNFPYNPNASQSASSKLLSATLTAKLHRCYMASLQVTKKT SLHEQKQQQQKAPTSLANTPTNGIVIKSEELDALLPEKSPLQVQEAEANWVYKKVQVDNNNQQFIKPLEDHHIEQMIEELLDYGSIEFFSGVTTQ

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G25190	AP2_ERF	ESE3	ethylene and salt inducible 3,...		Potri.006G261200 [exp]	0	1	PPLZ02.2
AT5G25190	AP2_ERF	ESE3	ethylene and salt inducible 3,...		Potri.018G021900 [exp]	1.00	0.8494
AT1G79420			Protein of unknown function (D...		Potri.008G081700 [exp]	2.44	0.7419
AT1G79760		DTA4	downstream target of AGL15-4 (...		Potri.011G047800 [exp]	7.07	0.7433	DTA4.2
AT5G59010			Protein kinase protein with te...		Potri.009G039500 [exp]	11.48	0.7406
AT1G10380			Putative membrane lipoprotein ...		Potri.008G095900 [exp]	12.24	0.7347
AT5G42340		PUB15	Plant U-Box 15 (.1)		Potri.004G205000 [exp]	24.08	0.6789
AT2G12646			PLATZ transcription factor fam...		Potri.018G116000 [exp]	24.37	0.6678
AT2G01950		VH1, BRL2	VASCULAR HIGHWAY 1, BRI1-like ...		Potri.010G101100 [exp]	24.39	0.7392
					Potri.016G001450 [exp]	25.25	0.6661
AT1G03010			Phototropic-responsive NPH3 fa...		Potri.014G133500 [exp]	28.80	0.7075

Compare expression of checked genes

Potri.006G261200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.