Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G75250 116 / 3e-35 MYB RSM3, ATRL6 RADIALIS-LIKE SANT/MYB 3, RAD-like 6 (.1.2) AT4G39250 111 / 6e-34 MYB RSM2, ATRL1 RADIALIS-LIKE SANT/MYB 2, RAD-like 1 (.1) AT2G21650 106 / 1e-31 MYB RSM1, ATRL2, MEE3 RADIALIS-LIKE SANT/MYB 1, MATERNAL EFFECT EMBRYO ARREST 3, ARABIDOPSIS RAD-LIKE 2, Homeodomain-like superfamily protein (.1) AT1G19510 100 / 2e-29 MYB RSM4, ATRL5 RADIALIS-LIKE SANT/MYB 4, RAD-like 5 (.1) AT2G18328 93 / 1e-26 MYB ATRL4 RAD-like 4 (.1) AT4G36570 83 / 6e-23 MYB ATRL3 RAD-like 3 (.1) AT5G05790 76 / 3e-18 MYB Duplicated homeodomain-like superfamily protein (.1) AT2G38090 76 / 4e-18 MYB MYB-R Duplicated homeodomain-like superfamily protein (.1) AT3G11280 74 / 1e-17 MYB Duplicated homeodomain-like superfamily protein (.1.2) AT5G58900 73 / 4e-17 MYB Homeodomain-like transcriptional regulator (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G122200 [exp] 149 / 5e-49 AT4G39250 112 / 3e-34 RADIALIS-LIKE SANT/MYB 2, RAD-like 1 (.1) Potri.009G117200 [exp] 123 / 2e-38 AT4G39250 109 / 1e-32 RADIALIS-LIKE SANT/MYB 2, RAD-like 1 (.1) Potri.004G155400 [exp] 122 / 2e-38 AT1G75250 124 / 4e-38 RADIALIS-LIKE SANT/MYB 3, RAD-like 6 (.1.2) Potri.004G155866 [exp] 121 / 9e-38 AT1G75250 113 / 5e-34 RADIALIS-LIKE SANT/MYB 3, RAD-like 6 (.1.2) Potri.009G116600 [exp] 116 / 5e-36 AT4G39250 120 / 4e-37 RADIALIS-LIKE SANT/MYB 2, RAD-like 1 (.1) Potri.005G228000 [exp] 114 / 3e-35 AT1G75250 115 / 5e-35 RADIALIS-LIKE SANT/MYB 3, RAD-like 6 (.1.2) Potri.002G035000 [exp] 114 / 6e-35 AT1G75250 122 / 5e-38 RADIALIS-LIKE SANT/MYB 3, RAD-like 6 (.1.2) Potri.002G260000 [exp] 102 / 3e-30 AT1G75250 108 / 3e-32 RADIALIS-LIKE SANT/MYB 3, RAD-like 6 (.1.2) Potri.007G025200 [exp] 97 / 5e-28 AT4G39250 99 / 1e-28 RADIALIS-LIKE SANT/MYB 2, RAD-like 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014301 [exp] 128 / 3e-40 AT1G75250 102 / 5e-30 RADIALIS-LIKE SANT/MYB 3, RAD-like 6 (.1.2) Lus10026009 [exp] 124 / 4e-39 AT1G75250 103 / 1e-30 RADIALIS-LIKE SANT/MYB 3, RAD-like 6 (.1.2) Lus10041752 [exp] 119 / 4e-37 AT1G75250 103 / 2e-30 RADIALIS-LIKE SANT/MYB 3, RAD-like 6 (.1.2) Lus10028306 [exp] 116 / 1e-35 AT1G75250 103 / 1e-30 RADIALIS-LIKE SANT/MYB 3, RAD-like 6 (.1.2) Lus10007152 [exp] 112 / 6e-34 AT1G75250 113 / 3e-34 RADIALIS-LIKE SANT/MYB 3, RAD-like 6 (.1.2) Lus10002538 [exp] 110 / 2e-33 AT1G75250 112 / 1e-33 RADIALIS-LIKE SANT/MYB 3, RAD-like 6 (.1.2) Lus10023564 [exp] 107 / 2e-32 AT1G75250 101 / 2e-29 RADIALIS-LIKE SANT/MYB 3, RAD-like 6 (.1.2) Lus10040450 [exp] 107 / 4e-32 AT1G75250 98 / 5e-28 RADIALIS-LIKE SANT/MYB 3, RAD-like 6 (.1.2) Lus10010831 [exp] 105 / 2e-31 AT1G75250 108 / 6e-32 RADIALIS-LIKE SANT/MYB 3, RAD-like 6 (.1.2) Lus10023568 [exp] 105 / 2e-31 AT4G39250 123 / 5e-38 RADIALIS-LIKE SANT/MYB 2, RAD-like 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0123 [poplar] [flax] HTH PF00249 [poplar] [flax] Myb_DNA-binding Myb-like DNA-binding domain
Representative CDS sequence Show only first row Show all	>Potri.007G023800.1 pacid=42766740 polypeptide=Potri.007G023800.1.p locus=Potri.007G023800 ID=Potri.007G023800.1.v4.1 annot-version=v4.1 ATGTCTTCCAATTCTCTCACCTCTTGGACACCTAAGCAAAACAAACTATTCGAAAAGGCCCTGGCTTTACATGACAAGGACACCCCTGACCGCTGGCATA ATGTTGCCAAAGCTGTGGGTGGGAAATCTGCAGAGGAAGTGAAGAGGCACTATGAGATTCTCATCAAGGATGTCAGGGAAATTGAGTCTGGCAGAGTTCC ATTCCCTAATTACAGGTCAAGTGGAAACGGCAACTAA
AA sequence Show only first row Show all	>Potri.007G023800.1 pacid=42766740 polypeptide=Potri.007G023800.1.p locus=Potri.007G023800 ID=Potri.007G023800.1.v4.1 annot-version=v4.1 MSSNSLTSWTPKQNKLFEKALALHDKDTPDRWHNVAKAVGGKSAEEVKRHYEILIKDVREIESGRVPFPNYRSSGNGN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G75250	MYB	RSM3, ATRL6	RADIALIS-LIKE SANT/MYB 3, RAD-...		Potri.007G023800 [exp]	0	1
					Potri.001G287500 [exp]	1.41	0.9574
AT2G29100		ATGLR2.9	GLUTAMATE RECEPTOR 2.9, gluta...		Potri.004G052500 [exp]	5.47	0.9470
AT1G21270		WAK2	wall-associated kinase 2 (.1)		Potri.009G154100 [exp]	6.00	0.9468
AT2G29120		ATGLR2.7	GLUTAMATE RECEPTOR 2.7, gluta...		Potri.018G012900 [exp]	8.83	0.9377
AT1G28960		ATNUDX15, ATNUD...	ARABIDOPSIS THALIANA NUDIX HYD...		Potri.016G121500 [exp]	8.94	0.9239
AT4G25640		FFT, ATDTX35	FLOWER FLAVONOID TRANSPORTER, ...		Potri.015G147600 [exp]	11.22	0.9365
AT3G45290		ATMLO3, MLO3	MILDEW RESISTANCE LOCUS O 3, S...		Potri.006G129700 [exp]	12.00	0.9349
AT1G74640			alpha/beta-Hydrolases superfam...		Potri.017G115100 [exp]	15.87	0.9292
AT5G53190		SWEET3, AtSWEET...	Nodulin MtN3 family protein (....		Potri.012G031400 [exp]	16.00	0.8959
AT2G35660		CTF2B, CTF2A	FAD/NAD(P)-binding oxidoreduct...		Potri.001G152600 [exp]	18.70	0.9443	Pt-CTF2.2

Compare expression of checked genes

Potri.007G023800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.