Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G39830 365 / 2e-124 Cupredoxin superfamily protein (.1) AT5G21100 250 / 1e-79 Plant L-ascorbate oxidase (.1) AT5G21105 246 / 3e-78 Plant L-ascorbate oxidase (.1.2.3) AT5G03260 122 / 1e-31 LAC11 laccase 11 (.1) AT2G30210 119 / 1e-30 LAC3 laccase 3 (.1) AT2G29130 119 / 2e-30 LAC2, ATLAC2 laccase 2 (.1) AT2G40370 118 / 2e-30 LAC5 laccase 5 (.1) AT5G05390 118 / 2e-30 LAC12 laccase 12 (.1) AT5G60020 118 / 3e-30 LAC17, ATLAC17 laccase 17 (.1) AT2G38080 117 / 7e-30 ATLMCO4, IRX12, LAC4 LACCASE 4, IRREGULAR XYLEM 12, ARABIDOPSIS LACCASE-LIKE MULTICOPPER OXIDASE 4, Laccase/Diphenol oxidase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G088358 [exp] 475 / 8e-168 AT4G39830 831 / 0.0 Cupredoxin superfamily protein (.1) Potri.007G088222 [exp] 467 / 3e-164 AT4G39830 847 / 0.0 Cupredoxin superfamily protein (.1) Potri.005G079400 [exp] 450 / 1e-157 AT4G39830 828 / 0.0 Cupredoxin superfamily protein (.1) Potri.010G171700 [exp] 377 / 5e-129 AT4G39830 799 / 0.0 Cupredoxin superfamily protein (.1) Potri.001G454700 [exp] 270 / 3e-87 AT4G39830 619 / 0.0 Cupredoxin superfamily protein (.1) Potri.009G159700 [exp] 244 / 3e-77 AT5G21105 760 / 0.0 Plant L-ascorbate oxidase (.1.2.3) Potri.001G219300 [exp] 244 / 5e-77 AT5G21105 758 / 0.0 Plant L-ascorbate oxidase (.1.2.3) Potri.014G100600 [exp] 134 / 8e-36 AT2G46570 831 / 0.0 laccase 6 (.1) Potri.009G042500 [exp] 133 / 1e-35 AT2G38080 891 / 0.0 LACCASE 4, IRREGULAR XYLEM 12, ARABIDOPSIS LACCASE-LIKE MULTICOPPER OXIDASE 4, Laccase/Diphenol oxidase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016808 [exp] 400 / 4e-138 AT4G39830 824 / 0.0 Cupredoxin superfamily protein (.1) Lus10022504 [exp] 400 / 8e-138 AT4G39830 828 / 0.0 Cupredoxin superfamily protein (.1) Lus10000871 [exp] 325 / 5e-109 AT4G39830 756 / 0.0 Cupredoxin superfamily protein (.1) Lus10009603 [exp] 324 / 2e-108 AT4G39830 754 / 0.0 Cupredoxin superfamily protein (.1) Lus10026753 [exp] 245 / 7e-78 AT5G21105 787 / 0.0 Plant L-ascorbate oxidase (.1.2.3) Lus10025538 [exp] 250 / 1e-76 AT5G21105 792 / 0.0 Plant L-ascorbate oxidase (.1.2.3) Lus10024378 [exp] 130 / 2e-34 AT5G60020 853 / 0.0 laccase 17 (.1) Lus10026512 [exp] 129 / 5e-34 AT5G03260 919 / 0.0 laccase 11 (.1) Lus10030235 [exp] 128 / 9e-34 AT2G46570 802 / 0.0 laccase 6 (.1) Lus10005976 [exp] 125 / 8e-33 AT2G46570 774 / 0.0 laccase 6 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0026 [poplar] [flax] CU_oxidase PF00394 [poplar] [flax] Cu-oxidase Multicopper oxidase CL0026 [poplar] [flax] CU_oxidase PF07732 [poplar] [flax] Cu-oxidase_3 Multicopper oxidase
Representative CDS sequence Show only first row Show all	>Potri.007G088290.1 pacid=42765387 polypeptide=Potri.007G088290.1.p locus=Potri.007G088290 ID=Potri.007G088290.1.v4.1 annot-version=v4.1 ATGTATGAGTACAAATCCCCCGATTGCTATAAGAAGCTGGTCATTACAATCAATGGAAGAACTCCTGGACCCACAATCCTTGCAAAGCAGAATGACACAG TTATTGTTGAGGTCAAGAACAGTTTGTTAACCGAGAATACAGCAATTCATTGGCACGGAATCCGTCAGATTGGAACACCTTGGTTTGATGGAACGGAAGG AGTCACTCAGCGTCCAATTCTGCCTGGAGACACTTTCGTATACAAGTTTGTTGTTGACAGGCCTGGGACATACTTATATCATGCCCATTATGGAATGCAA AGAGAAGCTGGGATATATGGATCGATTCGGGTAGCGCTTCCCGATGGAGAATCCGAACCCTTTGCTTATGATTATGATCGGAGCATCATCCTTACTGATT GGTATCACAAGAGCACGTATGAACAAGCTGCAGGATTGTCTTCAATTCCCTTTCAGTGGGTTGGGGAGCCTCAGTCACTTCTGATACAAGGAAAGGGAAG ATTTGACTGCTCCGCTGCCAATCCTCCCCTGAAAGCCGATGTCTGCAATAATACAAATCCTGAATGCTCTCTTTATTCTACGACTGTAGTCCCTGGAAAA ACGTATCGGCTTAGGATTAGTAGCTTGAGTGCTTTATCAGCTCTTAGTTTCCAGATAGAGGGTCACAACATGACTGTTGTTGAAGCTGATGGTCACTATG TGGAGCCATTTGTGGTAAGAATTTATTCATATACTCCGGCGAGACATGCAAACTGA
AA sequence Show only first row Show all	>Potri.007G088290.1 pacid=42765387 polypeptide=Potri.007G088290.1.p locus=Potri.007G088290 ID=Potri.007G088290.1.v4.1 annot-version=v4.1 MYEYKSPDCYKKLVITINGRTPGPTILAKQNDTVIVEVKNSLLTENTAIHWHGIRQIGTPWFDGTEGVTQRPILPGDTFVYKFVVDRPGTYLYHAHYGMQ REAGIYGSIRVALPDGESEPFAYDYDRSIILTDWYHKSTYEQAAGLSSIPFQWVGEPQSLLIQGKGRFDCSAANPPLKADVCNNTNPECSLYSTTVVPGK TYRLRISSLSALSALSFQIEGHNMTVVEADGHYVEPFVVRIYSYTPARHAN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G39830			Cupredoxin superfamily protein...		Potri.007G088290 [exp]	0	1
AT4G39830			Cupredoxin superfamily protein...		Potri.007G088358 [exp]	1.00	0.9849
AT4G39830			Cupredoxin superfamily protein...		Potri.007G088222 [exp]	2.44	0.9713
AT1G50600	GRAS	SCL5	scarecrow-like 5 (.1)		Potri.011G131100 [exp]	2.44	0.9635
AT4G37640		ACA2	calcium ATPase 2 (.1)		Potri.007G055500 [exp]	3.16	0.9642	Pt-ACA2.1
AT5G09360		LAC14	laccase 14 (.1)		Potri.019G088700 [exp]	4.00	0.9533
AT1G58290		AtHEMA1, HEMA1	Arabidopsis thaliana hemA 1, G...		Potri.009G080600 [exp]	4.89	0.9668
AT2G44260			Plant protein of unknown funct...		Potri.018G087400 [exp]	7.41	0.9444
AT3G52430		PAD4, ATPAD4	ARABIDOPSIS PHYTOALEXIN DEFICI...		Potri.005G068700 [exp]	8.48	0.9519
AT1G80840	WRKY	ATWRKY40, WRKY4...	WRKY DNA-binding protein 40 (....		Potri.003G182200 [exp]	8.77	0.9628	WRKY40.2
AT4G27220			NB-ARC domain-containing disea...		Potri.019G014328 [exp]	10.00	0.9104

Compare expression of checked genes

Potri.007G088290 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.