Pt-UCC1.1 (Potri.007G120200) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol Pt-UCC1.1
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G32300 119 / 2e-32 UCC1 uclacyanin 1 (.1)
AT1G72230 91 / 3e-22 Cupredoxin superfamily protein (.1)
AT5G07475 90 / 4e-22 Cupredoxin superfamily protein (.1)
AT3G60270 90 / 5e-22 Cupredoxin superfamily protein (.1)
AT3G27200 87 / 5e-21 Cupredoxin superfamily protein (.1)
AT2G31050 85 / 4e-20 Cupredoxin superfamily protein (.1)
AT2G26720 85 / 8e-20 Cupredoxin superfamily protein (.1)
AT2G44790 81 / 1e-18 UCC2 uclacyanin 2 (.1)
AT1G22480 76 / 5e-17 Cupredoxin superfamily protein (.1)
AT4G30590 76 / 7e-17 AtENODL12 early nodulin-like protein 12 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G080700 106 / 3e-28 AT5G07475 164 / 1e-51 Cupredoxin superfamily protein (.1)
Potri.003G150300 105 / 6e-28 AT5G07475 178 / 2e-57 Cupredoxin superfamily protein (.1)
Potri.014G049600 95 / 7e-24 AT3G60270 111 / 8e-31 Cupredoxin superfamily protein (.1)
Potri.001G332200 86 / 1e-20 AT3G27200 171 / 5e-55 Cupredoxin superfamily protein (.1)
Potri.002G101300 86 / 2e-20 AT1G72230 131 / 6e-39 Cupredoxin superfamily protein (.1)
Potri.003G047300 86 / 3e-20 AT5G26330 121 / 2e-34 Cupredoxin superfamily protein (.1)
Potri.002G101200 83 / 5e-19 AT1G72230 129 / 2e-37 Cupredoxin superfamily protein (.1)
Potri.002G161300 82 / 5e-19 AT5G26330 146 / 5e-45 Cupredoxin superfamily protein (.1)
Potri.006G259000 81 / 7e-19 AT5G26330 144 / 6e-44 Cupredoxin superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027143 156 / 3e-47 AT2G32300 137 / 9e-40 uclacyanin 1 (.1)
Lus10012085 95 / 7e-24 AT5G07475 142 / 4e-43 Cupredoxin superfamily protein (.1)
Lus10025580 94 / 2e-23 AT1G72230 112 / 4e-31 Cupredoxin superfamily protein (.1)
Lus10027043 94 / 3e-23 AT1G72230 112 / 4e-31 Cupredoxin superfamily protein (.1)
Lus10022350 93 / 4e-23 AT3G27200 169 / 7e-54 Cupredoxin superfamily protein (.1)
Lus10041570 90 / 6e-22 AT3G27200 167 / 2e-53 Cupredoxin superfamily protein (.1)
Lus10008720 87 / 5e-21 AT1G72230 140 / 2e-42 Cupredoxin superfamily protein (.1)
Lus10020944 87 / 1e-20 AT1G72230 141 / 1e-42 Cupredoxin superfamily protein (.1)
Lus10006657 89 / 2e-20 AT1G45063 106 / 1e-26 copper ion binding;electron carriers (.1.2)
Lus10002615 82 / 2e-19 AT5G26330 96 / 9e-26 Cupredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0026 CU_oxidase PF02298 Cu_bind_like Plastocyanin-like domain
Representative CDS sequence
>Potri.007G120200.1 pacid=42765617 polypeptide=Potri.007G120200.1.p locus=Potri.007G120200 ID=Potri.007G120200.1.v4.1 annot-version=v4.1
ATGGTGAGAACATTCACCAGCTTGGCCCTTATGGCCATGATGCTAAGATTGGCCATGGCTGCTAATTATACTGTTGGTGGTCCAAATGGTGGATGGGATG
CAACCACAAACCTGCAAGCTTGGGCAGCATCAAATCAATTCTTAGTTGGAGATAACCTCATCTTCCAGTATGGACTCGTGCATGATGTGAATGAAGTTTC
AAAGGCAGACTATGACTCCTGCCAGATAACTAGCCCACTAAAGTCATATAGTGGTGGCACAACAGTCATCCCTCTTTCTTCTCCTGGCAAGAGATACTTC
ACCTGTGCAACACCAGGACATTGTGCCGGAGGTATGAAGCTTGAAATAGACTCTCTTGCAACTTCTACCCCACCACCGGCCTCTCCCTTAACCCCGCCAC
CAGCCTCTCCCTTAACCCCACCGCCAGCTTCACCAAGCCTTCCATCACCTCCAACTACTTCGACTCTACCACCTGCTTCCACCGACATTCCTCCCGCTTC
CTCTCCAGCTCCAGAAATTTTTAATCTCTCACCATCACAATCACCAGAAATGACTCCAACAATGTCTCCTTCAGCCCCGCGTACCTCACCATTGACCAGT
CCTACACCATCTCCTGCAACTGCCCCTTCTATAGATGGTTTTATGAAAACACCTCTCGCGTCATCAGCTAGCAAAGAAAGTTTGCAACGCAGTCTCACAA
TGGGAATCAGCCTAGTTATCATGATGATACTTCTAGCTATCTAA
AA sequence
>Potri.007G120200.1 pacid=42765617 polypeptide=Potri.007G120200.1.p locus=Potri.007G120200 ID=Potri.007G120200.1.v4.1 annot-version=v4.1
MVRTFTSLALMAMMLRLAMAANYTVGGPNGGWDATTNLQAWAASNQFLVGDNLIFQYGLVHDVNEVSKADYDSCQITSPLKSYSGGTTVIPLSSPGKRYF
TCATPGHCAGGMKLEIDSLATSTPPPASPLTPPPASPLTPPPASPSLPSPPTTSTLPPASTDIPPASSPAPEIFNLSPSQSPEMTPTMSPSAPRTSPLTS
PTPSPATAPSIDGFMKTPLASSASKESLQRSLTMGISLVIMMILLAI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G32300 UCC1 uclacyanin 1 (.1) Potri.007G120200 0 1 Pt-UCC1.1
AT3G47400 Plant invertase/pectin methyle... Potri.012G126900 9.74 0.7912
AT3G05390 unknown protein Potri.004G083800 11.87 0.8748
Potri.019G016502 19.28 0.7668
AT2G28670 ESB1 ENHANCED SUBERIN 1, Disease re... Potri.008G049200 20.29 0.8541
AT2G28670 ESB1 ENHANCED SUBERIN 1, Disease re... Potri.010G211800 26.32 0.8486
AT1G71740 unknown protein Potri.005G198200 33.94 0.7909
AT2G37740 C2H2ZnF ATZFP10, ZFP10 zinc-finger protein 10 (.1) Potri.016G101400 40.90 0.8396 RBE.1
AT3G09220 LAC7 laccase 7 (.1) Potri.006G094100 43.17 0.8396 LAC110a
AT5G62280 Protein of unknown function (D... Potri.015G130500 91.82 0.8160
AT2G03360 Glycosyltransferase family 61 ... Potri.010G162100 96.49 0.8168

Potri.007G120200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.