Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G36930 233 / 1e-69 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT5G17680 196 / 2e-56 disease resistance protein (TIR-NBS-LRR class), putative (.1) AT5G46450 184 / 2e-52 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G41550 183 / 4e-52 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G41750 183 / 6e-52 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT5G49140 182 / 7e-52 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT4G11170 182 / 8e-52 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G41540 182 / 1e-51 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G51630 181 / 2e-51 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2), Disease resistance protein (TIR-NBS-LRR class) family (.3) AT5G38340 179 / 1e-50 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G142600 [exp] 506 / 2e-174 AT5G36930 535 / 5e-173 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.003G014200 [exp] 495 / 6e-168 AT5G36930 673 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T001933 [exp] 495 / 1e-167 AT5G36930 617 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T002200 [exp] 481 / 2e-164 AT5G36930 617 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G016425 [exp] 485 / 1e-163 AT5G36930 650 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.007G143300 [exp] 488 / 5e-163 AT5G36930 519 / 2e-162 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T011750 [exp] 480 / 9e-162 AT5G36930 551 / 2e-176 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G017082 [exp] 469 / 1e-158 AT5G36930 638 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G019710 [exp] 448 / 5e-157 AT5G36930 445 / 2e-144 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032101 [exp] 241 / 1e-76 AT1G27170 270 / 6e-80 transmembrane receptors;ATP binding (.1.2) Lus10014582 [exp] 233 / 2e-75 AT1G27170 186 / 9e-56 transmembrane receptors;ATP binding (.1.2) Lus10015453 [exp] 229 / 6e-72 AT1G27170 282 / 5e-84 transmembrane receptors;ATP binding (.1.2) Lus10039850 [exp] 233 / 2e-69 AT5G36930 573 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10018616 [exp] 225 / 2e-66 AT5G36930 578 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10008027 [exp] 206 / 3e-65 AT5G36930 197 / 5e-57 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10004719 [exp] 214 / 7e-63 AT5G36930 384 / 3e-113 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10030839 [exp] 214 / 8e-63 AT4G12010 552 / 7e-176 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10014207 [exp] 214 / 1e-62 AT5G36930 446 / 5e-135 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10001366 [exp] 214 / 2e-62 AT5G36930 424 / 1e-125 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF00931 [poplar] [flax] NB-ARC NB-ARC domain CL0173 [poplar] [flax] STIR PF13676 [poplar] [flax] TIR_2 TIR domain
Representative CDS sequence Show only first row Show all	>Potri.007G143100.4 pacid=42765962 polypeptide=Potri.007G143100.4.p locus=Potri.007G143100 ID=Potri.007G143100.4.v4.1 annot-version=v4.1 ATGCCGAAAGAAAAACGCAAACAATCCAAAGATGAAGAAAATGATTCATCCTCGCGAAAGAGAAGAAAAGCTGACCTCATGACTGCCATGACAGAGCCAG ATTCTTCTCGATCTAGACCACAAGGGGCCTATGATGTCTTTTTGAGTTTTAGAGGAGAAGATACTCGCAAGACATTTACAGATCATCTATATACTGCCTT AGTCCAAGCAGGAATCCACACTTTTCGAGATGATGATGAACTTCCTAGAGGAAAAGAAATCTCCGATCATCTCCTCGAGGCAATTCGAGAATCAAAGATA TCTACAGTGGTCTTCTCAAAAGGATATGCTTCTTCTAGATGGTGTCTCAATGAACTTGTGGAGATTCTCAAGTGCAGAAAGAGAAAAACTGGTCAGATTG CTCTTCCTATATTCTATGACATTGATCCTTCAGATGTGAGAAAACAGACTGGCAGTTTTGCTGAAGCATTTGTTAAACATGAAGAACGTTCTAAAGAGAA GGTGAAGGAGTGGAGAGAAACTCTTGAGGAGGCAGGAAATCTATCTGGATGGAATCTCAAAGATATGGCAAATGGGCATGAAGCAAAATTTATCCAAGAG ATTATCAAGGATGTGTTGACTAAATTGGACCCCAAGTACTTACATGTTCCTAAGCACCTAGTAGGTATTGATCCGCTTGCTCACAATATTTTTCACTTCC TAAGTACTGCAACAGATGATGTACGCATTGTGGGCATACATGGGATGCCAGGAATAGGAAAGACGACTATAGCAAAAGTTGTATTTAATCAACTCTGCTA TGACTGTGGATATGGATTCGAGGGAAGCTCATTTCTTTTGAATGTCAAAGAATCAGAATCTAAGGATATGGTTCTTCTACAGTAA
AA sequence Show only first row Show all	>Potri.007G143100.4 pacid=42765962 polypeptide=Potri.007G143100.4.p locus=Potri.007G143100 ID=Potri.007G143100.4.v4.1 annot-version=v4.1 MPKEKRKQSKDEENDSSSRKRRKADLMTAMTEPDSSRSRPQGAYDVFLSFRGEDTRKTFTDHLYTALVQAGIHTFRDDDELPRGKEISDHLLEAIRESKI STVVFSKGYASSRWCLNELVEILKCRKRKTGQIALPIFYDIDPSDVRKQTGSFAEAFVKHEERSKEKVKEWRETLEEAGNLSGWNLKDMANGHEAKFIQE IIKDVLTKLDPKYLHVPKHLVGIDPLAHNIFHFLSTATDDVRIVGIHGMPGIGKTTIAKVVFNQLCYDCGYGFEGSSFLLNVKESESKDMVLLQ

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G36930			Disease resistance protein (TI...		Potri.007G143100 [exp]	0	1
AT5G36930			Disease resistance protein (TI...		Potri.007G143200 [exp]	2.44	0.9809
AT5G17680			disease resistance protein (TI...		Potri.013G097000 [exp]	3.46	0.9547
AT5G36930			Disease resistance protein (TI...		Potri.007G142600 [exp]	4.58	0.9723
AT5G17680			disease resistance protein (TI...		Potri.013G098000 [exp]	17.02	0.9317
AT4G27220			NB-ARC domain-containing disea...		Potri.019G020102 [exp]	19.74	0.9458
AT5G36930			Disease resistance protein (TI...		Potri.013G096923 [exp]	21.16	0.9370
AT5G36930			Disease resistance protein (TI...		Potri.011G014301 [exp]	24.49	0.9389
AT3G53310	B3	REM20	AP2/B3-like transcriptional fa...		Potri.003G017566 [exp]	25.80	0.9364
AT5G17680			disease resistance protein (TI...		Potri.019G070001 [exp]	26.32	0.9504
AT2G01980		ATSOS1, SOS1, A...	ARABIDOPSIS SALT OVERLY SENSIT...		Potri.007G100500 [exp]	26.85	0.9532	Pt-NHX8.1

Compare expression of checked genes

Potri.007G143100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.