Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G04760 149 / 2e-45 MYB Duplicated homeodomain-like superfamily protein (.1) AT5G08520 128 / 3e-36 MYB Duplicated homeodomain-like superfamily protein (.1) AT1G49010 105 / 2e-27 MYB Duplicated homeodomain-like superfamily protein (.1) AT5G58900 104 / 4e-27 MYB Homeodomain-like transcriptional regulator (.1) AT2G38090 100 / 1e-25 MYB MYB-R Duplicated homeodomain-like superfamily protein (.1) AT3G11280 97 / 3e-24 MYB Duplicated homeodomain-like superfamily protein (.1.2) AT5G23650 93 / 2e-22 MYB Homeodomain-like transcriptional regulator (.1) AT5G05790 92 / 3e-22 MYB Duplicated homeodomain-like superfamily protein (.1) AT3G10580 91 / 4e-22 MYB Homeodomain-like superfamily protein (.1.2) AT5G01200 82 / 7e-19 MYB Duplicated homeodomain-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G240800 [exp] 214 / 3e-70 AT5G04760 232 / 3e-77 Duplicated homeodomain-like superfamily protein (.1) Potri.001G219100 [exp] 148 / 1e-44 AT5G04760 217 / 2e-71 Duplicated homeodomain-like superfamily protein (.1) Potri.007G076200 [exp] 119 / 7e-33 AT5G08520 293 / 6e-99 Duplicated homeodomain-like superfamily protein (.1) Potri.012G060300 [exp] 116 / 1e-31 AT1G49010 217 / 3e-69 Duplicated homeodomain-like superfamily protein (.1) Potri.005G087700 [exp] 114 / 8e-31 AT5G08520 304 / 2e-103 Duplicated homeodomain-like superfamily protein (.1) Potri.006G097300 [exp] 107 / 5e-28 AT2G38090 355 / 2e-123 Duplicated homeodomain-like superfamily protein (.1) Potri.016G112300 [exp] 107 / 6e-28 AT2G38090 358 / 9e-125 Duplicated homeodomain-like superfamily protein (.1) Potri.001G248800 [exp] 107 / 6e-28 AT5G58900 312 / 1e-106 Homeodomain-like transcriptional regulator (.1) Potri.009G042600 [exp] 106 / 8e-28 AT5G58900 307 / 1e-104 Homeodomain-like transcriptional regulator (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036413 [exp] 153 / 1e-46 AT5G04760 234 / 3e-78 Duplicated homeodomain-like superfamily protein (.1) Lus10041088 [exp] 149 / 6e-45 AT5G04760 233 / 1e-77 Duplicated homeodomain-like superfamily protein (.1) Lus10041001 [exp] 117 / 8e-32 AT5G08520 354 / 4e-123 Duplicated homeodomain-like superfamily protein (.1) Lus10013447 [exp] 114 / 9e-31 AT5G08520 350 / 2e-121 Duplicated homeodomain-like superfamily protein (.1) Lus10018209 [exp] 109 / 1e-28 AT5G58900 302 / 9e-103 Homeodomain-like transcriptional regulator (.1) Lus10040696 [exp] 108 / 2e-28 AT5G58900 306 / 2e-104 Homeodomain-like transcriptional regulator (.1) Lus10014837 [exp] 96 / 4e-24 AT3G11280 242 / 7e-80 Duplicated homeodomain-like superfamily protein (.1.2) Lus10009884 [exp] 96 / 9e-24 AT3G11280 246 / 4e-81 Duplicated homeodomain-like superfamily protein (.1.2) Lus10028264 [exp] 93 / 7e-23 AT3G11280 221 / 1e-71 Duplicated homeodomain-like superfamily protein (.1.2) Lus10035518 [exp] 90 / 2e-21 AT2G38090 304 / 1e-103 Duplicated homeodomain-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0123 [poplar] [flax] HTH PF00249 [poplar] [flax] Myb_DNA-binding Myb-like DNA-binding domain
Representative CDS sequence Show only first row Show all	>Potri.008G016400.3 pacid=42806900 polypeptide=Potri.008G016400.3.p locus=Potri.008G016400 ID=Potri.008G016400.3.v4.1 annot-version=v4.1 TCCTCATCATTCCTCCGCTCTGTGGATTCGCGAGGAGGACAATTTGAAGCGGCTCTGGTGAACTTTCCCGAGGAATTCCGGGATCGGTGGCAAAGAATCG GAGCTTACGTGGGACAATCGGCGTGGGAAGTTAAAGAACGCTACGAGATTCTAATACAGGATGTCTATGAGATTGATTCGGACCGTATTGAATTGCCACG TTATAAAGATGAAGAAGCTGTGAGTTGGGACTCCGGCGGCATGGTGGCTGCTGCAGCGCCGTCGGGTCAGATTTCTTGTGGTGGTAAAGCAAAACAAGAA GCTGAGGGAAGGAAAGGCAACCCTTGGACAGAGGAAGAACATAAGAGGTTTTTGACTGGATTAAGAAGGTTTGGTAGAGGTGACTGGAGAAGCATCTCAA TAAATGCAGTCATTACCAAAACACCCGTTCAAGTAACTAGTCATGCTCAGAAGTACTTCCTGCGACAGAATTCTGCGAATAATGAGAGGCGAGGGAGGAG AAGGGCGAGCACTCTTGACATTACCGCCGTGGATACCAAGACAGTTGCCTCATCATCTGAAGATAATTGGATTGCGCAGCCTGGTCCTCCAACTGATCGA GGTAGGGCACCGGTATAG
AA sequence Show only first row Show all	>Potri.008G016400.3 pacid=42806900 polypeptide=Potri.008G016400.3.p locus=Potri.008G016400 ID=Potri.008G016400.3.v4.1 annot-version=v4.1 SSSFLRSVDSRGGQFEAALVNFPEEFRDRWQRIGAYVGQSAWEVKERYEILIQDVYEIDSDRIELPRYKDEEAVSWDSGGMVAAAAPSGQISCGGKAKQE AEGRKGNPWTEEEHKRFLTGLRRFGRGDWRSISINAVITKTPVQVTSHAQKYFLRQNSANNERRGRRRASTLDITAVDTKTVASSSEDNWIAQPGPPTDR GRAPV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G04760	MYB		Duplicated homeodomain-like su...		Potri.008G016400 [exp]	0	1
AT5G24060			Pentatricopeptide repeat (PPR)...		Potri.004G072400 [exp]	17.49	0.7483
AT1G10010		AAP8, ATAAP8	amino acid permease 8 (.1)		Potri.013G103551 [exp]	21.70	0.7475
AT1G15390		PDF1A, ATDEF1	peptide deformylase 1A (.1)		Potri.001G171800 [exp]	31.74	0.6975	PDF1.2
AT2G03620		AtMRS2-5, AtMGT...	magnesium transporter 3 (.1.2)		Potri.010G158100 [exp]	32.64	0.6823
AT4G27220			NB-ARC domain-containing disea...		Potri.001G426660 [exp]	37.94	0.7036
AT3G09150		ATHY2, GUN3, HY...	GENOMES UNCOUPLED 3, ARABIDOPS...		Potri.009G048000 [exp]	40.24	0.7188
AT5G39940			FAD/NAD(P)-binding oxidoreduct...		Potri.004G130000 [exp]	44.87	0.6452
AT1G09575			Protein of unknown function (D...		Potri.013G161300 [exp]	46.69	0.7005
AT5G62270			unknown protein		Potri.017G017901 [exp]	58.66	0.6843
AT3G16230			Predicted eukaryotic LigT (.1....		Potri.001G186600 [exp]	63.26	0.6686

Compare expression of checked genes

Potri.008G016400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.