Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G43810 166 / 2e-55 Small nuclear ribonucleoprotein family protein (.1.2) AT3G59810 161 / 1e-53 Small nuclear ribonucleoprotein family protein (.1) AT4G30220 74 / 7e-19 RUXF small nuclear ribonucleoprotein F (.1.2) AT2G14285 54 / 3e-11 Small nuclear ribonucleoprotein family protein (.1) AT5G27720 41 / 1e-05 LSM4, EMB1644 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1) AT2G23930 36 / 0.0006 SNRNP-G probable small nuclear ribonucleoprotein G (.1.2) AT3G11500 35 / 0.001 Small nuclear ribonucleoprotein family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G178700 [exp] 184 / 2e-62 AT2G43810 150 / 4e-49 Small nuclear ribonucleoprotein family protein (.1.2) Potri.018G092200 [exp] 72 / 4e-18 AT4G30220 155 / 2e-51 small nuclear ribonucleoprotein F (.1.2) Potri.002G205700 [exp] 41 / 2e-05 AT5G27720 179 / 5e-59 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1) Potri.014G130700 [exp] 41 / 2e-05 AT5G27720 176 / 7e-58 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1) Potri.006G167000 [exp] 35 / 0.0007 AT2G14285 62 / 1e-14 Small nuclear ribonucleoprotein family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026860 [exp] 151 / 3e-46 AT5G36890 189 / 2e-56 beta glucosidase 42 (.1.2) Lus10037606 [exp] 70 / 3e-17 AT4G30220 173 / 2e-58 small nuclear ribonucleoprotein F (.1.2) Lus10006867 [exp] 50 / 1e-09 AT4G30220 119 / 4e-37 small nuclear ribonucleoprotein F (.1.2) Lus10004221 [exp] 39 / 0.0001 AT5G27720 182 / 2e-57 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1) Lus10017019 [exp] 38 / 0.0001 AT3G11500 150 / 2e-49 Small nuclear ribonucleoprotein family protein (.1) Lus10029426 [exp] 38 / 0.0003 AT5G27720 190 / 2e-58 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1) Lus10021342 [exp] 37 / 0.0003 AT3G11500 152 / 3e-50 Small nuclear ribonucleoprotein family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0527 [poplar] [flax] Sm-like PF01423 [poplar] [flax] LSM LSM domain
Representative CDS sequence Show only first row Show all	>Potri.008G078400.1 pacid=42807752 polypeptide=Potri.008G078400.1.p locus=Potri.008G078400 ID=Potri.008G078400.1.v4.1 annot-version=v4.1 ATGTCAACTGGAGGAGAGAAGGGTTCGGCAACCACAAAAACACCTGCTGATTTTCTCAAATCAATTCGTGGGCGGCCTGTTGTGGTTAAGCTCAATTCTG GAGTTGATTATAGAGGTATTTTAGCTTGTCTTGATGGGTACATGAACATAGCAATGGAACAAACAGAAGAATATGTAAATGGCCAACTGAAAAACAAATA TGGTGATGCTTTCATACGAGGAAATAATGTTCTGTACATCAGCACATCCAAGAGGACTCTTGCAGATGGTGCATAA
AA sequence Show only first row Show all	>Potri.008G078400.1 pacid=42807752 polypeptide=Potri.008G078400.1.p locus=Potri.008G078400 ID=Potri.008G078400.1.v4.1 annot-version=v4.1 MSTGGEKGSATTKTPADFLKSIRGRPVVVKLNSGVDYRGILACLDGYMNIAMEQTEEYVNGQLKNKYGDAFIRGNNVLYISTSKRTLADGA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G43810			Small nuclear ribonucleoprotei...		Potri.008G078400 [exp]	0	1
AT5G11280			unknown protein		Potri.006G251600 [exp]	1.00	0.8735
AT4G22330		ATCES1	Alkaline phytoceramidase (aPHC...		Potri.011G023401 [exp]	6.70	0.8444
AT5G25450			Cytochrome bd ubiquinol oxidas...		Potri.006G250000 [exp]	7.74	0.8035
AT3G05100			S-adenosyl-L-methionine-depend...		Potri.005G046300 [exp]	8.48	0.7859
AT1G22840		CYTC-1, ATCYTC-...	CYTOCHROME C-A, CYTOCHROME C-1...		Potri.019G076101 [exp]	10.00	0.8396
					Potri.005G149601 [exp]	12.20	0.7210
AT5G07900			Mitochondrial transcription te...		Potri.004G012400 [exp]	18.22	0.7464
AT3G18510			unknown protein		Potri.011G140300 [exp]	18.38	0.8035
AT4G12560		CPR1, CPR30	CONSTITUTIVE EXPRESSER OF PR G...		Potri.001G129400 [exp]	26.94	0.8077	CYP89A27P
AT5G25450			Cytochrome bd ubiquinol oxidas...		Potri.018G031400 [exp]	28.98	0.7901

Compare expression of checked genes

Potri.008G078400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.