Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G26330 182 / 5e-59 Cupredoxin superfamily protein (.1) AT2G26720 122 / 4e-35 Cupredoxin superfamily protein (.1) AT2G31050 117 / 3e-33 Cupredoxin superfamily protein (.1) AT2G32300 97 / 8e-25 UCC1 uclacyanin 1 (.1) AT2G02850 90 / 2e-23 ARPN plantacyanin (.1) AT3G17675 83 / 8e-21 Cupredoxin superfamily protein (.1) AT4G31840 83 / 3e-20 AtENODL15 early nodulin-like protein 15 (.1) AT3G27200 82 / 6e-20 Cupredoxin superfamily protein (.1) AT3G60270 79 / 1e-18 Cupredoxin superfamily protein (.1) AT3G53330 81 / 3e-18 plastocyanin-like domain-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G089900 [exp] 263 / 8e-91 AT5G26330 187 / 7e-61 Cupredoxin superfamily protein (.1) Potri.002G161300 [exp] 144 / 4e-44 AT5G26330 146 / 5e-45 Cupredoxin superfamily protein (.1) Potri.006G259000 [exp] 144 / 7e-44 AT5G26330 144 / 6e-44 Cupredoxin superfamily protein (.1) Potri.006G259101 [exp] 141 / 4e-43 AT5G26330 142 / 2e-43 Cupredoxin superfamily protein (.1) Potri.001G268700 [exp] 139 / 4e-42 AT5G26330 138 / 6e-42 Cupredoxin superfamily protein (.1) Potri.002G156100 [exp] 137 / 1e-41 AT5G26330 138 / 1e-41 Cupredoxin superfamily protein (.1) Potri.002G156401 [exp] 137 / 1e-41 AT5G26330 138 / 1e-41 Cupredoxin superfamily protein (.1) Potri.002G052500 [exp] 126 / 3e-37 AT5G26330 130 / 9e-39 Cupredoxin superfamily protein (.1) Potri.003G047300 [exp] 124 / 9e-36 AT5G26330 121 / 2e-34 Cupredoxin superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010533 [exp] 192 / 1e-62 AT5G26330 174 / 1e-55 Cupredoxin superfamily protein (.1) Lus10021925 [exp] 184 / 2e-59 AT5G26330 170 / 5e-54 Cupredoxin superfamily protein (.1) Lus10041211 [exp] 178 / 2e-57 AT5G26330 167 / 6e-53 Cupredoxin superfamily protein (.1) Lus10002451 [exp] 155 / 3e-48 AT5G26330 136 / 2e-40 Cupredoxin superfamily protein (.1) Lus10041850 [exp] 99 / 1e-26 AT2G02850 121 / 1e-36 plantacyanin (.1) Lus10041848 [exp] 97 / 3e-26 AT2G02850 130 / 4e-40 plantacyanin (.1) Lus10007025 [exp] 95 / 9e-25 AT2G32300 101 / 3e-27 uclacyanin 1 (.1) Lus10041849 [exp] 93 / 2e-24 AT2G02850 130 / 5e-40 plantacyanin (.1) Lus10007027 [exp] 94 / 4e-24 AT5G26330 100 / 5e-27 Cupredoxin superfamily protein (.1) Lus10006657 [exp] 96 / 9e-24 AT1G45063 106 / 1e-26 copper ion binding;electron carriers (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0026 [poplar] [flax] CU_oxidase PF02298 [poplar] [flax] Cu_bind_like Plastocyanin-like domain
Representative CDS sequence Show only first row Show all	>Potri.008G151000.1 pacid=42807799 polypeptide=Potri.008G151000.1.p locus=Potri.008G151000 ID=Potri.008G151000.1.v4.1 annot-version=v4.1 ATGGCTTTGGTGAAGAGAGCCCTGGCTCTGCTGATGTCAATCACATTAGCGATGGAGTTGATCCATGCAGCTGTGTACAAGGTTGGGGATTCTGCTGGTT GGACCACAATTGGCAACTTTGACTACAAAAAATGGTCTGCTACCAAGACCTTCCAAGTTCATGATATTATCCTTTTCAAATACAATGCTCAATTTCACAA TGTGATGCGAGTTACACATGCAATGTACAAAGCATGCAATACCTCTGCCCCTCTGGCAACCTACACCACCGGCAATGATTCGATCACTATCAAGACTCGT GGTCACCACTTCTTTTTCTGTGGTGTCCCTGGCCATTGCCAAGCTGGACAGAAGGTTGACATTAATGTACTACAAAGCAATGAAATGGCACCAACTTCGT CCGTTTCTTCTTCAGAGTCCTCTCCACCAGTTCCTTCTGCCAAAGTACCCGGGCCGGCCCCAAGTAATGCCATGCCATTGAAGGCTTTGAAAAGTCCTTC TGGAAACATTGGTTTGGCAATGGCTGTTTTGGCAACGTTTTGGATCAATTTTGCTTAA
AA sequence Show only first row Show all	>Potri.008G151000.1 pacid=42807799 polypeptide=Potri.008G151000.1.p locus=Potri.008G151000 ID=Potri.008G151000.1.v4.1 annot-version=v4.1 MALVKRALALLMSITLAMELIHAAVYKVGDSAGWTTIGNFDYKKWSATKTFQVHDIILFKYNAQFHNVMRVTHAMYKACNTSAPLATYTTGNDSITIKTR GHHFFFCGVPGHCQAGQKVDINVLQSNEMAPTSSVSSSESSPPVPSAKVPGPAPSNAMPLKALKSPSGNIGLAMAVLATFWINFA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G26330			Cupredoxin superfamily protein...		Potri.008G151000 [exp]	0	1
AT5G26330			Cupredoxin superfamily protein...		Potri.010G089900 [exp]	2.44	0.9339
AT1G06890			nodulin MtN21 /EamA-like trans...		Potri.019G128900 [exp]	4.00	0.9262
AT2G29050		ATRBL1	RHOMBOID-like 1 (.1.2)		Potri.001G241300 [exp]	4.24	0.9118
AT2G28410			unknown protein		Potri.004G211000 [exp]	4.24	0.8933
AT5G62710			Leucine-rich repeat protein ki...		Potri.012G071100 [exp]	6.00	0.9032
AT5G56890			Protein kinase superfamily pro...		Potri.006G152000 [exp]	7.07	0.9011
					Potri.018G139200 [exp]	8.00	0.8938
AT2G17940			Plant protein of unknown funct...		Potri.005G114400 [exp]	9.53	0.8883
AT5G48740			Leucine-rich repeat protein ki...		Potri.002G242700 [exp]	10.24	0.8845
AT2G41830			Uncharacterized protein (.1)		Potri.006G052100 [exp]	12.64	0.8805

Compare expression of checked genes

Potri.008G151000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.