Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G03870 182 / 1e-61 EMB2816 EMBRYO DEFECTIVE 2816, Small nuclear ribonucleoprotein family protein (.1.2) AT2G23930 59 / 8e-13 SNRNP-G probable small nuclear ribonucleoprotein G (.1.2) AT3G11500 58 / 2e-12 Small nuclear ribonucleoprotein family protein (.1) AT1G65700 43 / 2e-06 Small nuclear ribonucleoprotein family protein (.1.2.3) AT1G76860 42 / 4e-06 Small nuclear ribonucleoprotein family protein (.1) AT3G14080 42 / 4e-06 Small nuclear ribonucleoprotein family protein (.1.2) AT1G21190 39 / 4e-05 Small nuclear ribonucleoprotein family protein (.1) AT5G44500 39 / 0.0001 Small nuclear ribonucleoprotein family protein (.1.2) AT4G20440 39 / 0.0003 SMB small nuclear ribonucleoprotein associated protein B (.1.2.3.4)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G269500 [exp] 196 / 3e-67 AT2G03870 183 / 8e-62 EMBRYO DEFECTIVE 2816, Small nuclear ribonucleoprotein family protein (.1.2) Potri.006G211100 [exp] 58 / 1e-12 AT3G11500 153 / 2e-50 Small nuclear ribonucleoprotein family protein (.1) Potri.016G078100 [exp] 57 / 4e-12 AT3G11500 152 / 5e-50 Small nuclear ribonucleoprotein family protein (.1) Potri.001G278000 [exp] 43 / 2e-06 AT1G65700 146 / 3e-47 Small nuclear ribonucleoprotein family protein (.1.2.3) Potri.002G068800 [exp] 42 / 4e-06 AT1G76860 175 / 1e-58 Small nuclear ribonucleoprotein family protein (.1) Potri.005G191600 [exp] 42 / 4e-06 AT1G76860 176 / 3e-59 Small nuclear ribonucleoprotein family protein (.1) Potri.001G440100 [exp] 37 / 0.0006 AT4G20440 211 / 2e-67 small nuclear ribonucleoprotein associated protein B (.1.2.3.4) Potri.011G155700 [exp] 37 / 0.0007 AT4G20440 218 / 2e-70 small nuclear ribonucleoprotein associated protein B (.1.2.3.4)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035639 [exp] 189 / 2e-64 AT2G03870 179 / 3e-60 EMBRYO DEFECTIVE 2816, Small nuclear ribonucleoprotein family protein (.1.2) Lus10017019 [exp] 58 / 1e-12 AT3G11500 150 / 2e-49 Small nuclear ribonucleoprotein family protein (.1) Lus10021342 [exp] 57 / 4e-12 AT3G11500 152 / 3e-50 Small nuclear ribonucleoprotein family protein (.1) Lus10042884 [exp] 42 / 3e-06 AT1G65700 158 / 7e-52 Small nuclear ribonucleoprotein family protein (.1.2.3) Lus10026326 [exp] 41 / 1e-05 AT1G76860 176 / 4e-59 Small nuclear ribonucleoprotein family protein (.1) Lus10040487 [exp] 40 / 1e-05 AT1G76860 175 / 8e-59 Small nuclear ribonucleoprotein family protein (.1) Lus10011293 [exp] 40 / 1e-05 AT1G76860 175 / 8e-59 Small nuclear ribonucleoprotein family protein (.1) Lus10028183 [exp] 40 / 4e-05 AT1G65700 155 / 8e-51 Small nuclear ribonucleoprotein family protein (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0527 [poplar] [flax] Sm-like PF01423 [poplar] [flax] LSM LSM domain
Representative CDS sequence Show only first row Show all	>Potri.009G064000.1 pacid=42772135 polypeptide=Potri.009G064000.1.p locus=Potri.009G064000 ID=Potri.009G064000.1.v4.1 annot-version=v4.1 ATGTCCGGAAGGAAAGAAACAGTATTGGATTTGGCTAAGTTTGTGGACAAGGGTGTTCAAGTCAAGCTCACTGGTGGTAGACAAGTGACTGGGACTTTGA AGGGATACGATCAATTGCTAAACCTTGTCCTGGATGAAGCAGTAGAATTTCTAAGAGATGCTGATGATCCACTAAAGACCACTGACCAGACAAGGCGCCT TGGCCTGATTGTTTGCAGGGGAACTGCAGTGATGCTGGTGTCACCAACTGATGGTACGGATGAGATTGCCAACCCTTTTGTCCAGCCAGATGGGGCCTAG
AA sequence Show only first row Show all	>Potri.009G064000.1 pacid=42772135 polypeptide=Potri.009G064000.1.p locus=Potri.009G064000 ID=Potri.009G064000.1.v4.1 annot-version=v4.1 MSGRKETVLDLAKFVDKGVQVKLTGGRQVTGTLKGYDQLLNLVLDEAVEFLRDADDPLKTTDQTRRLGLIVCRGTAVMLVSPTDGTDEIANPFVQPDGA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G03870		EMB2816	EMBRYO DEFECTIVE 2816, Small n...		Potri.009G064000 [exp]	0	1
AT5G55940		EMB2731	embryo defective 2731, Unchara...		Potri.001G370200 [exp]	1.41	0.8147
					Potri.016G052400 [exp]	5.00	0.8224
AT3G54400			Eukaryotic aspartyl protease f...		Potri.001G028200 [exp]	12.44	0.7884
AT5G41050			Pollen Ole e 1 allergen and ex...		Potri.017G068400 [exp]	14.24	0.7718
AT4G39900			unknown protein		Potri.007G093200 [exp]	14.45	0.7696
AT1G68350			unknown protein		Potri.010G122600 [exp]	14.49	0.7945
AT1G75060			unknown protein		Potri.002G133500 [exp]	16.43	0.7711
AT4G18590			Nucleic acid-binding, OB-fold-...		Potri.010G239200 [exp]	17.20	0.7936
AT3G16300			Uncharacterised protein family...		Potri.003G050400 [exp]	18.33	0.7610
AT5G58490			NAD(P)-binding Rossmann-fold s...		Potri.009G076300 [exp]	18.43	0.7467	Pt-CCR.7

Compare expression of checked genes

Potri.009G064000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.