Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G26330 87 / 6e-22 Cupredoxin superfamily protein (.1) AT2G31050 87 / 1e-21 Cupredoxin superfamily protein (.1) AT2G32300 88 / 2e-21 UCC1 uclacyanin 1 (.1) AT3G27200 81 / 2e-19 Cupredoxin superfamily protein (.1) AT5G07475 80 / 5e-19 Cupredoxin superfamily protein (.1) AT3G17675 78 / 5e-19 Cupredoxin superfamily protein (.1) AT2G26720 79 / 2e-18 Cupredoxin superfamily protein (.1) AT1G72230 76 / 2e-17 Cupredoxin superfamily protein (.1) AT2G25060 72 / 4e-16 AtENODL14 early nodulin-like protein 14 (.1) AT4G31840 72 / 5e-16 AtENODL15 early nodulin-like protein 15 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G030450 [exp] 96 / 3e-25 AT3G17675 106 / 2e-30 Cupredoxin superfamily protein (.1) Potri.013G030000 [exp] 95 / 5e-25 AT3G17675 106 / 2e-30 Cupredoxin superfamily protein (.1) Potri.003G047300 [exp] 93 / 8e-24 AT5G26330 121 / 2e-34 Cupredoxin superfamily protein (.1) Potri.003G117900 [exp] 89 / 1e-22 AT3G17675 108 / 6e-31 Cupredoxin superfamily protein (.1) Potri.002G161300 [exp] 88 / 2e-22 AT5G26330 146 / 5e-45 Cupredoxin superfamily protein (.1) Potri.006G259101 [exp] 87 / 4e-22 AT5G26330 142 / 2e-43 Cupredoxin superfamily protein (.1) Potri.006G259000 [exp] 86 / 1e-21 AT5G26330 144 / 6e-44 Cupredoxin superfamily protein (.1) Potri.001G332200 [exp] 86 / 2e-21 AT3G27200 171 / 5e-55 Cupredoxin superfamily protein (.1) Potri.001G043600 [exp] 86 / 2e-21 AT5G15350 121 / 2e-35 early nodulin-like protein 17 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012165 [exp] 135 / 2e-40 AT5G07475 89 / 1e-22 Cupredoxin superfamily protein (.1) Lus10007582 [exp] 140 / 4e-39 AT4G35110 120 / 2e-29 Arabidopsis phospholipase-like protein (PEARLI 4) family (.1), Arabidopsis phospholipase-like protein (PEARLI 4) family (.2), Arabidopsis phospholipase-like protein (PEARLI 4) family (.3), Arabidopsis phospholipase-like protein (PEARLI 4) family (.4) Lus10002614 [exp] 92 / 3e-24 AT2G32300 100 / 1e-26 uclacyanin 1 (.1) Lus10041849 [exp] 89 / 5e-23 AT2G02850 130 / 5e-40 plantacyanin (.1) Lus10041850 [exp] 87 / 2e-22 AT2G02850 121 / 1e-36 plantacyanin (.1) Lus10008720 [exp] 89 / 3e-22 AT1G72230 140 / 2e-42 Cupredoxin superfamily protein (.1) Lus10010533 [exp] 88 / 3e-22 AT5G26330 174 / 1e-55 Cupredoxin superfamily protein (.1) Lus10041570 [exp] 87 / 7e-22 AT3G27200 167 / 2e-53 Cupredoxin superfamily protein (.1) Lus10022350 [exp] 84 / 2e-20 AT3G27200 169 / 7e-54 Cupredoxin superfamily protein (.1) Lus10020944 [exp] 83 / 4e-20 AT1G72230 141 / 1e-42 Cupredoxin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0026 [poplar] [flax] CU_oxidase PF02298 [poplar] [flax] Cu_bind_like Plastocyanin-like domain
Representative CDS sequence Show only first row Show all	>Potri.009G136200.1 pacid=42772235 polypeptide=Potri.009G136200.1.p locus=Potri.009G136200 ID=Potri.009G136200.1.v4.1 annot-version=v4.1 ATGGGAGAGGCCAAGATCTTCCTAATGATCTTAATTATGGTGTTCTTGAAAGGTGCTGTATCTGAAGTTCATACAGTTGGGGATGAGTTAGGATGGAATA CGGGGGCAAACTTTGGTTCTTGGTCACGGAAATATAATTTTAGCGTTGGCGATACTCTTGTTTTTAAGTATGTGAAGGGACAGCACAACGTGTATGAAGT GATTGAGGCTACATATCGATCATGCAATGGAAGCACTGGAGTTTTAGCGACATATGAGAGTGGAAATGATCAAATTGAACTCAATAAAGCAAAGAAATAT TGGTTCGTTTGCAATTTTGCTGGGCATTGCCTTGGAGGCATGAGGTTTTTCATCGATGTTAAAGAAGCTAATTCCACAAATATTAGGCCAACCACACCAC AAAGTGAACCAATTCCACCACCACCACCAGCCAACTCCTGTGCTGCCATTTACGTCTTTGATGGATGGAGTTTTTGGGTTTCTCTTGTTGCTTTTGGAGT TTTACTCCAGTTGTAA
AA sequence Show only first row Show all	>Potri.009G136200.1 pacid=42772235 polypeptide=Potri.009G136200.1.p locus=Potri.009G136200 ID=Potri.009G136200.1.v4.1 annot-version=v4.1 MGEAKIFLMILIMVFLKGAVSEVHTVGDELGWNTGANFGSWSRKYNFSVGDTLVFKYVKGQHNVYEVIEATYRSCNGSTGVLATYESGNDQIELNKAKKY WFVCNFAGHCLGGMRFFIDVKEANSTNIRPTTPQSEPIPPPPPANSCAAIYVFDGWSFWVSLVAFGVLLQL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G26330			Cupredoxin superfamily protein...		Potri.009G136200 [exp]	0	1
AT1G43710		EMB1075	embryo defective 1075, Pyridox...		Potri.005G190500 [exp]	7.74	0.7051
					Potri.017G084700 [exp]	12.84	0.6421
AT4G12070			unknown protein		Potri.018G050100 [exp]	13.30	0.6958
AT5G12890			UDP-Glycosyltransferase superf...		Potri.017G077400 [exp]	22.18	0.7020
					Potri.006G138450 [exp]	22.80	0.6305
AT5G12890			UDP-Glycosyltransferase superf...		Potri.017G077700 [exp]	24.89	0.6841
AT5G43540	C2H2ZnF		C2H2 and C2HC zinc fingers sup...		Potri.005G221500 [exp]	26.83	0.6947
AT5G60920		COB	COBRA-like extracellular glyco...		Potri.015G060000 [exp]	27.87	0.6649
AT3G12580		ATHSP70, HSP70	ARABIDOPSIS HEAT SHOCK PROTEIN...		Potri.008G054733 [exp]	30.65	0.6574
AT5G10750			Protein of unknown function (D...		Potri.018G014234 [exp]	32.09	0.5377

Compare expression of checked genes

Potri.009G136200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.