Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-ERF1.2,ERF33
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G23240 201 / 2e-65 AP2_ERF ERF1, ATERF1 ethylene response factor 1 (.1) AT2G31230 140 / 2e-41 AP2_ERF ATERF15 ethylene-responsive element binding factor 15 (.1) AT1G06160 130 / 2e-37 AP2_ERF ORA59 octadecanoid-responsive Arabidopsis AP2/ERF 59 (.1) AT5G47220 94 / 3e-23 AP2_ERF ATERF-2, ERF2, ATERF2 ETHYLENE RESPONSE FACTOR- 2, ethylene responsive element binding factor 2 (.1) AT4G17500 92 / 3e-22 AP2_ERF ATERF-1, AtERF1 ethylene responsive element binding factor 1 (.1) AT2G44840 86 / 2e-20 AP2_ERF ATERF13, EREBP ethylene-responsive element binding factor 13 (.1) AT5G51190 86 / 3e-20 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT5G43410 83 / 3e-20 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT3G23230 83 / 4e-20 AP2_ERF ERF98 Integrase-type DNA-binding superfamily protein (.1) AT3G23220 81 / 2e-19 AP2_ERF ESE1 ethylene and salt inducible 1, Integrase-type DNA-binding superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G166200 [exp] 327 / 7e-115 AT3G23240 202 / 1e-65 ethylene response factor 1 (.1) Potri.002G039100 [exp] 212 / 1e-69 AT3G23240 147 / 3e-44 ethylene response factor 1 (.1) Potri.005G223200 [exp] 211 / 4e-69 AT3G23240 165 / 4e-51 ethylene response factor 1 (.1) Potri.013G045200 [exp] 190 / 6e-61 AT3G23240 167 / 5e-52 ethylene response factor 1 (.1) Potri.019G014409 [exp] 185 / 7e-59 AT3G23240 161 / 1e-49 ethylene response factor 1 (.1) Potri.005G223300 [exp] 158 / 4e-48 AT3G23240 163 / 5e-50 ethylene response factor 1 (.1) Potri.002G039000 [exp] 156 / 2e-47 AT3G23240 138 / 2e-40 ethylene response factor 1 (.1) Potri.011G061700 [exp] 111 / 2e-30 AT3G23240 111 / 1e-30 ethylene response factor 1 (.1) Potri.004G051700 [exp] 107 / 4e-29 AT5G47220 111 / 1e-30 ETHYLENE RESPONSE FACTOR- 2, ethylene responsive element binding factor 2 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021193 [exp] 221 / 5e-73 AT3G23240 209 / 2e-68 ethylene response factor 1 (.1) Lus10011829 [exp] 213 / 2e-69 AT3G23240 209 / 4e-68 ethylene response factor 1 (.1) Lus10014655 [exp] 162 / 1e-49 AT3G23240 202 / 3e-65 ethylene response factor 1 (.1) Lus10006579 [exp] 149 / 2e-44 AT3G23240 211 / 4e-69 ethylene response factor 1 (.1) Lus10022015 [exp] 140 / 2e-41 AT3G23240 176 / 1e-55 ethylene response factor 1 (.1) Lus10022935 [exp] 117 / 1e-31 AT2G31230 145 / 4e-42 ethylene-responsive element binding factor 15 (.1) Lus10003562 [exp] 115 / 2e-31 AT3G23240 146 / 1e-43 ethylene response factor 1 (.1) Lus10033885 [exp] 113 / 2e-30 AT3G23240 142 / 7e-42 ethylene response factor 1 (.1) Lus10042557 [exp] 111 / 2e-30 AT3G23240 155 / 7e-48 ethylene response factor 1 (.1) Lus10027469 [exp] 109 / 3e-29 AT3G23240 145 / 2e-43 ethylene response factor 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0081 [poplar] [flax] MBD-like PF00847 [poplar] [flax] AP2 AP2 domain
Representative CDS sequence Show only first row Show all	>Potri.010G072300.1 pacid=42797433 polypeptide=Potri.010G072300.1.p locus=Potri.010G072300 ID=Potri.010G072300.1.v4.1 annot-version=v4.1 ATGGATGCCTCCATCTTTCACTCTGCAAATTCTGATTTCTCATCCGAATCTTGTTTTAGATCACCAGACTCTTTTTATAGCCAATCTTTTAACCAAAGTT CTCTCCCTTTCAATGAAAATGACTCCGACGAAATGCTTCTTTTTGAACTAATCTCGGAGGCCACTCAAGAAACATCAAGAACAACTTTCTGTAATGGAAT TGTTAAGGAAGAAGAGGTCAGTTCAGTTGCCAAAAGAACTCCCGACAAGGAAAAGTCCTACAGGGGTGTTAGGAGGCGGCCATGGGGCAAATTCGCAGCG GAGATAAGGGATTCCACAAGGAATGGCATAAGGGTATGGTTAGGCACATTTGACAGTGCAGAAGCAGCTGCTTTGGCTTATGATCAAGCTGCTTTTTCGA TGAGAGGACCTGGGACTATACTAAATTTCCCAGTTGAAAGAGTGAGGGAGTCGCTTAAGGATATGAAGTGTAGTCATCATTATGAGGATGGGTGCTCACC TGTGGTGGCTCTAAAGAGAAAGTACTCCATGAGAAGGAAATTGGGAAGCAGGGGCAAGAAAGAGAGGAATGCAAGGATAGAAAATGTAGTCGTTTTGGAA GATCTAGGTGCTGATTATTTGGAACAACTGTTGAATTCATCTGGAAAGGCTACGAGTCCTTGGTGA
AA sequence Show only first row Show all	>Potri.010G072300.1 pacid=42797433 polypeptide=Potri.010G072300.1.p locus=Potri.010G072300 ID=Potri.010G072300.1.v4.1 annot-version=v4.1 MDASIFHSANSDFSSESCFRSPDSFYSQSFNQSSLPFNENDSDEMLLFELISEATQETSRTTFCNGIVKEEEVSSVAKRTPDKEKSYRGVRRRPWGKFAA EIRDSTRNGIRVWLGTFDSAEAAALAYDQAAFSMRGPGTILNFPVERVRESLKDMKCSHHYEDGCSPVVALKRKYSMRRKLGSRGKKERNARIENVVVLE DLGADYLEQLLNSSGKATSPW

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G23240	AP2_ERF	ERF1, ATERF1	ethylene response factor 1 (.1...		Potri.010G072300 [exp]	0	1	Pt-ERF1.2,ERF33
AT2G30130	AS2	PCK1, LBD12, AS...	PEACOCK 1, Lateral organ bound...		Potri.010G184400 [exp]	1.00	0.9071
AT2G29060	GRAS		GRAS family transcription fact...		Potri.001G242000 [exp]	1.41	0.8747
AT3G23220	AP2_ERF	ESE1	ethylene and salt inducible 1,...		Potri.010G072600 [exp]	3.16	0.8153
AT1G03940			HXXXD-type acyl-transferase fa...		Potri.019G118000 [exp]	3.46	0.8642
AT3G61440		ATCYSC1, ARATH;...	BETA-SUBSTITUTED ALA SYNTHASE ...		Potri.014G086300 [exp]	4.47	0.7667
AT3G23230	AP2_ERF	ERF98	Integrase-type DNA-binding sup...		Potri.010G072400 [exp]	4.58	0.7997
					Potri.006G038201 [exp]	5.65	0.8338
AT2G35215			unknown protein		Potri.003G092100 [exp]	9.38	0.7636
AT4G18220			Drug/metabolite transporter su...		Potri.001G352200 [exp]	11.61	0.6993
AT5G10830			S-adenosyl-L-methionine-depend...		Potri.005G066200 [exp]	13.85	0.7490

Compare expression of checked genes

Potri.010G072300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.