Potri.010G072400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G23230 84 / 1e-21 AP2_ERF ERF98 Integrase-type DNA-binding superfamily protein (.1)
AT3G23220 72 / 2e-16 AP2_ERF ESE1 ethylene and salt inducible 1, Integrase-type DNA-binding superfamily protein (.1)
AT5G43410 71 / 2e-16 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT1G06160 73 / 4e-16 AP2_ERF ORA59 octadecanoid-responsive Arabidopsis AP2/ERF 59 (.1)
AT1G04370 67 / 4e-15 AP2_ERF ATERF14 Ethylene-responsive element binding factor 14 (.1)
AT5G51190 69 / 5e-15 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT5G47220 69 / 6e-15 AP2_ERF ATERF-2, ERF2, ATERF2 ETHYLENE RESPONSE FACTOR- 2, ethylene responsive element binding factor 2 (.1)
AT4G17500 69 / 8e-15 AP2_ERF ATERF-1, AtERF1 ethylene responsive element binding factor 1 (.1)
AT5G61600 69 / 8e-15 AP2_ERF ERF104 ethylene response factor 104 (.1)
AT5G47230 69 / 1e-14 AP2_ERF ATERF5, ATERF-5, ERF5 ETHYLENE RESPONSIVE ELEMENT BINDING FACTOR- 5, ethylene responsive element binding factor 5 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G166100 122 / 2e-36 AT3G23230 82 / 2e-20 Integrase-type DNA-binding superfamily protein (.1)
Potri.002G039200 85 / 8e-22 AT3G23230 113 / 7e-33 Integrase-type DNA-binding superfamily protein (.1)
Potri.005G223100 82 / 1e-20 AT3G23230 101 / 2e-28 Integrase-type DNA-binding superfamily protein (.1)
Potri.010G072600 79 / 3e-19 AT3G23220 91 / 4e-24 ethylene and salt inducible 1, Integrase-type DNA-binding superfamily protein (.1)
Potri.002G039300 75 / 1e-17 AT3G23220 82 / 2e-20 ethylene and salt inducible 1, Integrase-type DNA-binding superfamily protein (.1)
Potri.008G166000 73 / 3e-17 AT3G23230 94 / 3e-25 Integrase-type DNA-binding superfamily protein (.1)
Potri.003G151000 73 / 2e-16 AT5G07580 164 / 6e-50 Integrase-type DNA-binding superfamily protein (.1)
Potri.001G079600 72 / 6e-16 AT5G07580 145 / 1e-42 Integrase-type DNA-binding superfamily protein (.1)
Potri.003G150800 72 / 1e-15 AT5G51190 185 / 7e-58 Integrase-type DNA-binding superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021873 88 / 1e-22 AT3G23230 143 / 4e-44 Integrase-type DNA-binding superfamily protein (.1)
Lus10011830 80 / 2e-19 AT3G23230 134 / 4e-41 Integrase-type DNA-binding superfamily protein (.1)
Lus10022936 77 / 1e-18 AT3G23230 114 / 9e-34 Integrase-type DNA-binding superfamily protein (.1)
Lus10024883 77 / 2e-18 AT3G23230 130 / 3e-39 Integrase-type DNA-binding superfamily protein (.1)
Lus10004752 76 / 3e-17 AT5G07580 122 / 4e-34 Integrase-type DNA-binding superfamily protein (.1)
Lus10033884 73 / 3e-17 AT3G23230 125 / 9e-38 Integrase-type DNA-binding superfamily protein (.1)
Lus10007841 76 / 4e-17 AT5G47230 121 / 4e-33 ETHYLENE RESPONSIVE ELEMENT BINDING FACTOR- 5, ethylene responsive element binding factor 5 (.1)
Lus10021196 71 / 3e-16 AT3G23230 131 / 3e-40 Integrase-type DNA-binding superfamily protein (.1)
Lus10011831 71 / 3e-16 AT3G23230 132 / 2e-40 Integrase-type DNA-binding superfamily protein (.1)
Lus10032499 72 / 1e-15 AT5G51190 186 / 8e-59 Integrase-type DNA-binding superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0081 MBD-like PF00847 AP2 AP2 domain
Representative CDS sequence
>Potri.010G072400.1 pacid=42799739 polypeptide=Potri.010G072400.1.p locus=Potri.010G072400 ID=Potri.010G072400.1.v4.1 annot-version=v4.1
ATGGAAGAGCCTGATAAAGGGAAGGAAAAGGAATTGAAAGGGAGAGAAGAGGTTCGATACCGGGGTGTTCGAAGGAGACCTTGGGGAAAATTTGCGGCGG
AAATACGAGACCCATCAAGGCAGGGAGCAAGGTTATGGTTAGGGACATTTGATACGGCAGAGGAGGCAGCTCGTGCTTATGATAGAGCTGCATTTAGCAT
GAGAGGTCATCTTGCAATCCTCAACTTTCCTAATGATTATCTCTCTCAAGCGATAGGATCTTCTCCTCGTCGTCCACCAGTTTCATCATCTAGTAGTGAT
GTTGGTGCAAGCGAGAGTTTTCAGAGGGGAAGCTCATCAAGTGCCGGACAAGGAAAGCAAGTTATCGAGTTTGAGTACTTGGATGATAAGATTTTGGAGG
AGCTTCTTGAAACAGAAGAGGAGAAGAAGAAACGGCAGCAAGATTGA
AA sequence
>Potri.010G072400.1 pacid=42799739 polypeptide=Potri.010G072400.1.p locus=Potri.010G072400 ID=Potri.010G072400.1.v4.1 annot-version=v4.1
MEEPDKGKEKELKGREEVRYRGVRRRPWGKFAAEIRDPSRQGARLWLGTFDTAEEAARAYDRAAFSMRGHLAILNFPNDYLSQAIGSSPRRPPVSSSSSD
VGASESFQRGSSSSAGQGKQVIEFEYLDDKILEELLETEEEKKKRQQD

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G23230 AP2_ERF ERF98 Integrase-type DNA-binding sup... Potri.010G072400 0 1
AT5G10830 S-adenosyl-L-methionine-depend... Potri.005G066200 1.00 0.8223
AT3G48140 B12D protein (.1) Potri.008G179401 2.23 0.7660
AT3G23220 AP2_ERF ESE1 ethylene and salt inducible 1,... Potri.010G072600 2.44 0.8115
AT3G23240 AP2_ERF ERF1, ATERF1 ethylene response factor 1 (.1... Potri.010G072300 4.58 0.7997 Pt-ERF1.2,ERF33
AT3G61440 ATCYSC1, ARATH;... BETA-SUBSTITUTED ALA SYNTHASE ... Potri.014G086300 4.89 0.7507
AT2G29060 GRAS GRAS family transcription fact... Potri.001G242000 5.29 0.7941
AT2G03800 GEK1 GEKO1, D-aminoacyl-tRNA deacyl... Potri.015G048700 6.63 0.6766
AT2G01300 unknown protein Potri.004G093000 10.95 0.6914
AT3G16640 TCTP translationally controlled tum... Potri.005G024800 13.78 0.7113 Pt-TCTP.1
AT3G15760 unknown protein Potri.018G131100 14.07 0.6831

Potri.010G072400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.