Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G26330 187 / 1e-60 Cupredoxin superfamily protein (.1) AT2G26720 117 / 5e-33 Cupredoxin superfamily protein (.1) AT2G31050 114 / 4e-32 Cupredoxin superfamily protein (.1) AT2G32300 98 / 3e-25 UCC1 uclacyanin 1 (.1) AT2G02850 87 / 3e-22 ARPN plantacyanin (.1) AT3G17675 83 / 8e-21 Cupredoxin superfamily protein (.1) AT3G27200 84 / 2e-20 Cupredoxin superfamily protein (.1) AT4G31840 82 / 8e-20 AtENODL15 early nodulin-like protein 15 (.1) AT1G45063 83 / 2e-19 copper ion binding;electron carriers (.1.2) AT5G07475 81 / 5e-19 Cupredoxin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G151000 [exp] 267 / 2e-92 AT5G26330 183 / 2e-59 Cupredoxin superfamily protein (.1) Potri.002G161300 [exp] 145 / 2e-44 AT5G26330 146 / 5e-45 Cupredoxin superfamily protein (.1) Potri.006G259000 [exp] 145 / 2e-44 AT5G26330 144 / 6e-44 Cupredoxin superfamily protein (.1) Potri.006G259101 [exp] 144 / 5e-44 AT5G26330 142 / 2e-43 Cupredoxin superfamily protein (.1) Potri.001G268700 [exp] 140 / 9e-43 AT5G26330 138 / 6e-42 Cupredoxin superfamily protein (.1) Potri.002G156100 [exp] 139 / 4e-42 AT5G26330 138 / 1e-41 Cupredoxin superfamily protein (.1) Potri.002G156401 [exp] 139 / 4e-42 AT5G26330 138 / 1e-41 Cupredoxin superfamily protein (.1) Potri.003G047300 [exp] 128 / 4e-37 AT5G26330 121 / 2e-34 Cupredoxin superfamily protein (.1) Potri.002G052500 [exp] 124 / 2e-36 AT5G26330 130 / 9e-39 Cupredoxin superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010533 [exp] 196 / 4e-64 AT5G26330 174 / 1e-55 Cupredoxin superfamily protein (.1) Lus10021925 [exp] 188 / 5e-61 AT5G26330 170 / 5e-54 Cupredoxin superfamily protein (.1) Lus10041211 [exp] 186 / 4e-60 AT5G26330 167 / 6e-53 Cupredoxin superfamily protein (.1) Lus10002451 [exp] 158 / 5e-49 AT5G26330 136 / 2e-40 Cupredoxin superfamily protein (.1) Lus10041848 [exp] 95 / 3e-25 AT2G02850 130 / 4e-40 plantacyanin (.1) Lus10041850 [exp] 95 / 3e-25 AT2G02850 121 / 1e-36 plantacyanin (.1) Lus10007025 [exp] 96 / 4e-25 AT2G32300 101 / 3e-27 uclacyanin 1 (.1) Lus10007027 [exp] 94 / 1e-24 AT5G26330 100 / 5e-27 Cupredoxin superfamily protein (.1) Lus10012165 [exp] 94 / 3e-24 AT5G07475 89 / 1e-22 Cupredoxin superfamily protein (.1) Lus10002615 [exp] 92 / 7e-24 AT5G26330 96 / 9e-26 Cupredoxin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0026 [poplar] [flax] CU_oxidase PF02298 [poplar] [flax] Cu_bind_like Plastocyanin-like domain
Representative CDS sequence Show only first row Show all	>Potri.010G089900.1 pacid=42800023 polypeptide=Potri.010G089900.1.p locus=Potri.010G089900 ID=Potri.010G089900.1.v4.1 annot-version=v4.1 ATGGCTTTGGTGATGAGGGCCGTGGCTCTGCTGACAGTAATGACATTAATGCTGGAGTTGATCCATGCAGCGGTGTACAAGGTTGGGGACTCTGCTGGTT GGACCGCTAGCGGTAACATTGACTACAAACAATGGTCTGCTACCAAGACATTTCAAGTTGGTGACGTAATCCTTTTCGAATACAATGCTCAATTTCACAA TGTGATGCGAGTTACACATGCAATGTACAAAGCATGCAATACCTCTGCCCCTATGGCAACCTACACCACCGGCAATGATTCAATCACTATCAAGACTCGT CGTCACCATTTCTTTTTCTGTGGTGTCCCTGGCCATTGCCAAGCTGGACAGAAAGTTGACATTAATGTGCTACGGAGCGATGAAAGGGCACAAACTCCTG CATCTTCTTCAATGTCCTCCCCGCCAGTTCCTTCTGCCAAAGTAGCCGGGCCGGCCTCAAGTAATGCCTTGTCATTGAAGGCTTTGAGAAGTCCTTTTGG TAGCTTTGGTTTGGCAATGGCTGTTTTGGCAACGTTTTTTTATATCAATCTTGCTTAA
AA sequence Show only first row Show all	>Potri.010G089900.1 pacid=42800023 polypeptide=Potri.010G089900.1.p locus=Potri.010G089900 ID=Potri.010G089900.1.v4.1 annot-version=v4.1 MALVMRAVALLTVMTLMLELIHAAVYKVGDSAGWTASGNIDYKQWSATKTFQVGDVILFEYNAQFHNVMRVTHAMYKACNTSAPMATYTTGNDSITIKTR RHHFFFCGVPGHCQAGQKVDINVLRSDERAQTPASSSMSSPPVPSAKVAGPASSNALSLKALRSPFGSFGLAMAVLATFFYINLA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G26330			Cupredoxin superfamily protein...		Potri.010G089900 [exp]	0	1
AT1G06890			nodulin MtN21 /EamA-like trans...		Potri.019G128900 [exp]	2.00	0.9455
AT5G26330			Cupredoxin superfamily protein...		Potri.008G151000 [exp]	2.44	0.9339
					Potri.018G139200 [exp]	3.31	0.9228
AT5G41950			Tetratricopeptide repeat (TPR)...		Potri.003G146200 [exp]	3.46	0.9534
AT1G10630		ATARFA1F	ADP-ribosylation factor A1F (....		Potri.002G191400 [exp]	4.47	0.9413	ARF1.2
AT4G27270			Quinone reductase family prote...		Potri.001G410700 [exp]	6.70	0.9220	Pt-FQR1.1
AT5G62710			Leucine-rich repeat protein ki...		Potri.012G071100 [exp]	6.70	0.9239
AT4G27270			Quinone reductase family prote...		Potri.004G028900 [exp]	7.14	0.9216
AT1G64650			Major facilitator superfamily ...		Potri.003G145600 [exp]	7.34	0.9435
AT5G42080		RSW9, DRP1A, AG...	RADIAL SWELLING 9, DYNAMIN-REL...		Potri.001G090600 [exp]	9.79	0.9228	ADL1.1

Compare expression of checked genes

Potri.010G089900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.