Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G25890 96 / 3e-22 AP2_ERF CRF11 cytokinin response factor 11, Integrase-type DNA-binding superfamily protein (.1.2) AT1G68550 92 / 5e-21 AP2_ERF CRF10 cytokinin response factor 10, Integrase-type DNA-binding superfamily protein (.1.2) AT1G12890 65 / 5e-12 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT4G28140 61 / 2e-10 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT4G23750 61 / 4e-10 AP2_ERF TMO3, CRF2 TARGET OF MONOPTEROS 3, cytokinin response factor 2 (.1.2) AT5G18560 61 / 4e-10 AP2_ERF PUCHI Integrase-type DNA-binding superfamily protein (.1) AT1G43160 59 / 5e-10 AP2_ERF RAP2.6, RAP2.06 related to AP2 6 (.1) AT1G28160 59 / 6e-10 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT2G33710 59 / 6e-10 AP2_ERF Integrase-type DNA-binding superfamily protein (.1.2) AT3G61630 60 / 7e-10 AP2_ERF CRF6 cytokinin response factor 6 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G120100 [exp] 392 / 2e-137 AT3G25890 124 / 4e-33 cytokinin response factor 11, Integrase-type DNA-binding superfamily protein (.1.2) Potri.012G032900 [exp] 71 / 2e-13 AT4G27950 214 / 6e-67 cytokinin response factor 4 (.1) Potri.015G023200 [exp] 66 / 6e-12 AT4G27950 211 / 9e-66 cytokinin response factor 4 (.1) Potri.015G054500 [exp] 66 / 7e-12 AT1G49120 61 / 4e-10 cytokinin response factor 9, Integrase-type DNA-binding superfamily protein (.1) Potri.001G094800 [exp] 63 / 7e-11 AT4G23750 177 / 2e-52 TARGET OF MONOPTEROS 3, cytokinin response factor 2 (.1.2) Potri.019G131300 [exp] 62 / 8e-11 AT4G27950 139 / 2e-38 cytokinin response factor 4 (.1) Potri.013G158500 [exp] 62 / 8e-11 AT4G27950 124 / 1e-32 cytokinin response factor 4 (.1) Potri.007G076800 [exp] 61 / 2e-10 AT2G33710 104 / 2e-26 Integrase-type DNA-binding superfamily protein (.1.2) Potri.001G067600 [exp] 59 / 5e-10 AT5G13330 130 / 1e-37 related to AP2 6l (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035018 [exp] 238 / 2e-76 AT3G25890 150 / 2e-42 cytokinin response factor 11, Integrase-type DNA-binding superfamily protein (.1.2) Lus10021678 [exp] 230 / 2e-73 AT3G25890 154 / 4e-44 cytokinin response factor 11, Integrase-type DNA-binding superfamily protein (.1.2) Lus10034316 [exp] 203 / 4e-63 AT1G68550 151 / 2e-43 cytokinin response factor 10, Integrase-type DNA-binding superfamily protein (.1.2) Lus10041456 [exp] 191 / 2e-58 AT1G68550 146 / 3e-41 cytokinin response factor 10, Integrase-type DNA-binding superfamily protein (.1.2) Lus10027573 [exp] 62 / 2e-10 AT4G27950 209 / 1e-64 cytokinin response factor 4 (.1) Lus10017550 [exp] 61 / 3e-10 AT4G23750 172 / 2e-51 TARGET OF MONOPTEROS 3, cytokinin response factor 2 (.1.2) Lus10033938 [exp] 59 / 1e-09 AT4G23750 201 / 6e-62 TARGET OF MONOPTEROS 3, cytokinin response factor 2 (.1.2) Lus10022426 [exp] 59 / 1e-09 AT5G61890 170 / 1e-51 Integrase-type DNA-binding superfamily protein (.1) Lus10033963 [exp] 59 / 2e-09 AT5G18560 186 / 4e-56 Integrase-type DNA-binding superfamily protein (.1) Lus10005343 [exp] 56 / 2e-09 AT5G25190 174 / 3e-56 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0081 [poplar] [flax] MBD-like PF00847 [poplar] [flax] AP2 AP2 domain
Representative CDS sequence Show only first row Show all	>Potri.010G125600.1 pacid=42798367 polypeptide=Potri.010G125600.1.p locus=Potri.010G125600 ID=Potri.010G125600.1.v4.1 annot-version=v4.1 ATGTCACCAAAAAGACAGTCTTTGCTTTACACTAAAACCGGCAATAAAACCAACGATAATAAACGAATCTTGTCGCAGGAGTCTAAAATGGAGTCCACAA TGAGAAAAATCCGTGTCATCTGTTATGATCCGTATGCTACCGAATCCGATTCCAGTGATGATGAATCTGACAAGAAATCGTCTAGAAAACGTTTTGTGCG AGAAATCAATCTTCCTTTGGTTGTCACCCCCCAGCCAAAAGCCTTTGAGCCTGAGAGTTCCTGTCAAGACAGTAATAATAGTGCTAAATCCCCCGGTAAG AAGATGAGGGTTTTGCCTGAAACCCCAACATCAACTTTCGAAGCGAAGAAACTAGCACCAAAGAAACCTGTTGGTGTTAGGCAAAGGAAATGGGGTAAAT GGGCAGCTGAGATTCGGAATCCAGTGACCAAAGCGAGAACGTGGTTGGGTACTTTCGATACTCTTGAAGAAGCTGCCCAAGCCTACGAGGCAAAGAAGCA GGAATATGAGGCTTTGGCTATGTTAGCCTCTGAAAAAAGTCAAAACATTTCATCATCTCTGGCCATCTCTCAATCTCATTCTCACAACAGCAGCAAAAAA CAAGTCAGTTTTGCATCTTCTGGGGATAGTGATGATAGCGTTGTTTCGCGTACTTCCCCTGCTTCTGTTCTCGAGCTTGACACTTCTATGGTGTCAAATG TTACTGGTGAATGTGATCTCGTGATCAAATATGAAGACATTGGTTCTTCTGTTGCGAATCTTGAGATACCTGATTTGGATTTTATGAACGATCCTTTGGC ATCTTGTCCAATAGATCAAGATCTGAACTTGGGTCTCGACTTTGGTAATCTTATTGACGAGTTTGGTCGATTTTATGATGATTACTGTGTTATTGATGAT CTTGATATTTGCGGGCTAAATGGCGAAGAACCAGGCGAGCTTCCTGATTATGATTTTGAGTTTGGCAACGAGGAATTCACTTATTTGGATGATCATCAAC AGAAACCCCTCAACATTGCATGCCAATAA
AA sequence Show only first row Show all	>Potri.010G125600.1 pacid=42798367 polypeptide=Potri.010G125600.1.p locus=Potri.010G125600 ID=Potri.010G125600.1.v4.1 annot-version=v4.1 MSPKRQSLLYTKTGNKTNDNKRILSQESKMESTMRKIRVICYDPYATESDSSDDESDKKSSRKRFVREINLPLVVTPQPKAFEPESSCQDSNNSAKSPGK KMRVLPETPTSTFEAKKLAPKKPVGVRQRKWGKWAAEIRNPVTKARTWLGTFDTLEEAAQAYEAKKQEYEALAMLASEKSQNISSSLAISQSHSHNSSKK QVSFASSGDSDDSVVSRTSPASVLELDTSMVSNVTGECDLVIKYEDIGSSVANLEIPDLDFMNDPLASCPIDQDLNLGLDFGNLIDEFGRFYDDYCVIDD LDICGLNGEEPGELPDYDFEFGNEEFTYLDDHQQKPLNIACQ

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G25890	AP2_ERF	CRF11	cytokinin response factor 11, ...		Potri.010G125600 [exp]	0	1
AT1G25472		CPuORF54	conserved peptide upstream ope...		Potri.010G125700 [exp]	1.00	0.8802
AT4G38180	FAR1_related	FRS5	FAR1-related sequence 5 (.1)		Potri.011G145800 [exp]	4.69	0.8083
AT2G16070		PDV2	plastid division2 (.1.2)		Potri.004G149900 [exp]	8.30	0.8003
AT1G49540		ELP2, AtELP2	Elongator subunit 2, elongator...		Potri.010G119600 [exp]	8.83	0.7747
AT2G41140		CRK1, ATCRK1, A...	CDPK-related kinase 1 (.1)		Potri.016G035500 [exp]	14.24	0.7742	CRK1.2
AT5G04840	bZIP		bZIP protein (.1)		Potri.010G242800 [exp]	14.69	0.7293
AT5G57140		ATPAP28, PAP28	purple acid phosphatase 28 (.1...		Potri.006G074300 [exp]	16.73	0.7597
AT1G29790			S-adenosyl-L-methionine-depend...		Potri.011G079000 [exp]	24.67	0.7346
AT1G21980		ATPIPK1, ATPIP5...	phosphatidylinositol-4-phospha...		Potri.004G139900 [exp]	34.08	0.7492
AT1G34360			translation initiation factor ...		Potri.009G137000 [exp]	36.66	0.6745

Compare expression of checked genes

Potri.010G125600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.