Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G36930 112 / 2e-28 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT1G27170 111 / 3e-28 transmembrane receptors;ATP binding (.1.2) AT5G41540 89 / 3e-20 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G72840 87 / 9e-20 Disease resistance protein (TIR-NBS-LRR class) (.1), Disease resistance protein (TIR-NBS-LRR class) (.2) AT1G72860 83 / 3e-18 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G41750 82 / 4e-18 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT5G48770 82 / 4e-18 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G63860 81 / 9e-18 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT5G18360 81 / 1e-17 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G41550 79 / 1e-16 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G012801 [exp] 396 / 1e-141 AT1G27170 136 / 6e-36 transmembrane receptors;ATP binding (.1.2) Potri.011G008740 [exp] 338 / 7e-113 AT5G36930 420 / 7e-132 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.011G009400 [exp] 338 / 1e-111 AT5G36930 504 / 4e-162 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.011G008164 [exp] 342 / 6e-111 AT5G36930 491 / 3e-154 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.011G009251 [exp] 338 / 2e-109 AT5G36930 508 / 1e-160 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.006G283500 [exp] 312 / 1e-106 AT5G36930 235 / 8e-69 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.006G283800 [exp] 312 / 1e-105 AT5G36930 286 / 1e-85 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.006G282900 [exp] 313 / 2e-103 AT5G36930 361 / 1e-110 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.011G008292 [exp] 322 / 3e-103 AT5G36930 454 / 2e-140 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005171 [exp] 191 / 7e-56 AT1G27170 576 / 0.0 transmembrane receptors;ATP binding (.1.2) Lus10018972 [exp] 183 / 6e-54 AT5G36930 192 / 3e-51 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10033825 [exp] 184 / 9e-54 AT5G36930 400 / 3e-123 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10011741 [exp] 152 / 3e-42 AT5G36930 540 / 4e-172 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10039850 [exp] 136 / 8e-37 AT5G36930 573 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10032101 [exp] 131 / 6e-36 AT1G27170 270 / 6e-80 transmembrane receptors;ATP binding (.1.2) Lus10018616 [exp] 133 / 1e-35 AT5G36930 578 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10015453 [exp] 129 / 3e-35 AT1G27170 282 / 5e-84 transmembrane receptors;ATP binding (.1.2) Lus10023272 [exp] 111 / 4e-28 AT5G36930 423 / 4e-126 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10007812 [exp] 105 / 4e-26 AT5G36930 359 / 4e-106 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF00931 [poplar] [flax] NB-ARC NB-ARC domain CL0173 [poplar] [flax] STIR PF01582 [poplar] [flax] TIR TIR domain
Representative CDS sequence Show only first row Show all	>Potri.011G012950.7 pacid=42781076 polypeptide=Potri.011G012950.7.p locus=Potri.011G012950 ID=Potri.011G012950.7.v4.1 annot-version=v4.1 ATGATCATGGAACGTAAGAGGAATACTGACTGCATAATTTTGCCGGTCTTCTATGATGTGGATCCGTCTGAAGTCAGAAATCAAACAGGGAGCTTTGCTG CAGCATTTGTGGATCATGAAAAGCGCTTCAAGAAGGAGATGGAGCAAGTGAATGGGTGGAGGATTGCTTTGAAGGAAGTTGCAGATTTAGGAGGAATCGT TTTAGGAGATGGGTATGAGGCACAGCTTGTCCAATCTATCGTGGAGAAGGTCTCAAAGAATCTGGATCGTAAAATATTTCATGTCCCCCTTCATTTCATT GGAAGAGATCATCTGGTAAAATATATCAACTCATGGTTGCAAGATGGCACCCATGGTGCTGCTATTGCTATACTCTATGGGATTGGTGGAGTTGGGAAGA CAGCCATAGCAAAAACTGTTTATAACCAGAACTTTCATAAATTTGAAGGCAGGAGCTTTCTATCAAATGTTAGAGAAAGGTCAAAAGAATCCAATGGTGT AGTTTGTCTACAGAGGCAACTTCTTTCTGATATCCTAAACAAGACTGCTGATGAGACACATGATGTCGATGAAGGGATTATAAAGATTAAGGATGCATTG TGTTGCAGAAGAACTCTTATTGTTCTCGATGACGTGGACAAATGGTACTAG
AA sequence Show only first row Show all	>Potri.011G012950.7 pacid=42781076 polypeptide=Potri.011G012950.7.p locus=Potri.011G012950 ID=Potri.011G012950.7.v4.1 annot-version=v4.1 MIMERKRNTDCIILPVFYDVDPSEVRNQTGSFAAAFVDHEKRFKKEMEQVNGWRIALKEVADLGGIVLGDGYEAQLVQSIVEKVSKNLDRKIFHVPLHFI GRDHLVKYINSWLQDGTHGAAIAILYGIGGVGKTAIAKTVYNQNFHKFEGRSFLSNVRERSKESNGVVCLQRQLLSDILNKTADETHDVDEGIIKIKDAL CCRRTLIVLDDVDKWY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G36930			Disease resistance protein (TI...		Potri.011G012950 [exp]	0	1
AT1G27170			transmembrane receptors;ATP bi...		Potri.006G282100 [exp]	11.13	0.8995
AT1G27170			transmembrane receptors;ATP bi...		Potri.011G012801 [exp]	25.09	0.8918
AT3G22400		ATLOX5, LOX5	Arabidopsis thaliana lipoxygen...		Potri.008G151500 [exp]	25.65	0.8948	LOX1.8
AT3G26120		TEL1	terminal EAR1-like 1 (.1)		Potri.008G183000 [exp]	28.56	0.8955
AT5G21930		ATHMA8, HMA8, P...	ARABIDOPSIS HEAVY METAL ATPASE...		Potri.006G220301 [exp]	40.47	0.8812
AT5G37020	ARF	ARF8, ATARF8	auxin response factor 8 (.1.2)		Potri.017G141000 [exp]	40.69	0.8375
AT3G14470			NB-ARC domain-containing disea...		Potri.012G123000 [exp]	42.98	0.8878
AT5G41750			Disease resistance protein (TI...		Potri.011G012851 [exp]	52.99	0.8459
AT1G17820			Putative integral membrane pro...		Potri.018G152400 [exp]	53.58	0.8644
AT1G45616		AtRLP6	receptor like protein 6 (.1)		Potri.012G024900 [exp]	56.28	0.8646

Compare expression of checked genes

Potri.011G012950 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.