Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G50940 190 / 2e-58 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT3G50930 179 / 3e-53 BCS1 cytochrome BC1 synthesis (.1) AT5G17730 176 / 7e-53 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT5G17760 174 / 7e-52 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2) AT2G18193 171 / 8e-51 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT2G18190 167 / 3e-49 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT3G28600 160 / 6e-47 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT4G05380 154 / 9e-47 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT3G28570 158 / 4e-46 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT3G28610 158 / 4e-46 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G032700 [exp] 206 / 2e-64 AT3G50930 437 / 1e-149 cytochrome BC1 synthesis (.1) Potri.007G020500 [exp] 196 / 1e-60 AT2G18193 511 / 1e-179 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.007G020900 [exp] 192 / 1e-58 AT3G50930 561 / 0.0 cytochrome BC1 synthesis (.1) Potri.008G177200 [exp] 190 / 4e-58 AT3G50940 401 / 4e-136 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.010G057900 [exp] 187 / 1e-57 AT3G50930 396 / 1e-133 cytochrome BC1 synthesis (.1) Potri.007G012400 [exp] 187 / 3e-57 AT3G50940 367 / 2e-123 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.005G119900 [exp] 186 / 2e-56 AT5G17760 512 / 3e-179 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2) Potri.007G020600 [exp] 186 / 2e-56 AT2G18193 553 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.011G111200 [exp] 182 / 1e-55 AT3G50940 302 / 2e-98 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015802 [exp] 198 / 3e-61 AT3G50940 462 / 9e-161 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10037004 [exp] 193 / 2e-59 AT3G50930 457 / 9e-159 cytochrome BC1 synthesis (.1) Lus10028463 [exp] 184 / 5e-56 AT3G50930 340 / 2e-111 cytochrome BC1 synthesis (.1) Lus10041918 [exp] 185 / 2e-55 AT3G50930 383 / 2e-126 cytochrome BC1 synthesis (.1) Lus10024275 [exp] 182 / 7e-55 AT3G50940 434 / 2e-149 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10025989 [exp] 169 / 8e-51 AT3G50930 445 / 1e-153 cytochrome BC1 synthesis (.1) Lus10014284 [exp] 171 / 9e-51 AT3G50930 535 / 0.0 cytochrome BC1 synthesis (.1) Lus10007391 [exp] 171 / 1e-50 AT3G50940 424 / 2e-145 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10003213 [exp] 163 / 2e-47 AT5G17740 430 / 7e-146 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10006968 [exp] 142 / 3e-41 AT5G57480 399 / 3e-137 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF00004 [poplar] [flax] AAA ATPase family associated with various cellular activities (AAA)
Representative CDS sequence Show only first row Show all	>Potri.011G111101.1 pacid=42780907 polypeptide=Potri.011G111101.1.p locus=Potri.011G111101 ID=Potri.011G111101.1.v4.1 annot-version=v4.1 ATGAACGCAGAGGAATATTACAGAAATTCTAGCAAAAAATGGAAACGTTGTTACTTGATATACGGTCCTCCTGGCACCGGCAAGTCAAGCTTGACCGCAG CAATGGCTAATCACTTAAAATATGACATCTATGACTTGGATGTATCAGAATTCGACAACAATCCAGATTATTTAGAGCGCTGGTTGATCCCTGGACTGCC CAGTCGAACTGTAGTCGTAGTTGAGGATATAGACTGCACTATCAAGCCACAAAACCAAGGTGAAAAAAAGGTAAAGGTCTCGGATATACTTAAACAACTT CGGTTGTGCGCTGGAGATGGACAGATTGTTGTTTTCACAACCAATCACATAGACATGCTCGACCCAGAATTGTTGACTCCTGATCTGATGAACATGCACA TTCACATGCCATATTGCACCATTTCTGCTTTCAACCAAATAGCTTTCAACTATTTCAATATTTCCCATCACATACTCTTCGAGGAGATTGAAGGTCTTAT AAAGAAGGTTGGAGTTACTCTTGCAGAAATTTCAGGAGAGCTTCTGAAGAGTAGCGATGCTGAAGTTTCCCTCCAAGGCCTAATCAAATTTCTTCACAAC AAGATTGCTGAATATGACAAGTTCAAAGCTTAG
AA sequence Show only first row Show all	>Potri.011G111101.1 pacid=42780907 polypeptide=Potri.011G111101.1.p locus=Potri.011G111101 ID=Potri.011G111101.1.v4.1 annot-version=v4.1 MNAEEYYRNSSKKWKRCYLIYGPPGTGKSSLTAAMANHLKYDIYDLDVSEFDNNPDYLERWLIPGLPSRTVVVVEDIDCTIKPQNQGEKKVKVSDILKQL RLCAGDGQIVVFTTNHIDMLDPELLTPDLMNMHIHMPYCTISAFNQIAFNYFNISHHILFEEIEGLIKKVGVTLAEISGELLKSSDAEVSLQGLIKFLHN KIAEYDKFKA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G50940			P-loop containing nucleoside t...		Potri.011G111101 [exp]	0	1
					Potri.004G187300 [exp]	7.48	0.9574
AT5G48380		BIR1	BAK1-interacting receptor-like...		Potri.017G005150 [exp]	15.74	0.9610
AT4G19390			Uncharacterised protein family...		Potri.014G039000 [exp]	26.83	0.9601
AT3G53310	B3	REM20	AP2/B3-like transcriptional fa...		Potri.004G220000 [exp]	30.13	0.9598
AT5G60900		RLK1	receptor-like protein kinase 1...		Potri.001G014100 [exp]	35.28	0.9595
					Potri.001G091400 [exp]	41.58	0.9591
AT5G24090		ATCHIA	chitinase A (.1)		Potri.015G024000 [exp]	46.76	0.9586
AT5G24090		ATCHIA	chitinase A (.1)		Potri.015G024100 [exp]	53.77	0.9578	Pt-CHI3.8
AT5G06740			Concanavalin A-like lectin pro...		Potri.004G209300 [exp]	53.88	0.9580
AT2G29120		ATGLR2.7	GLUTAMATE RECEPTOR 2.7, gluta...		Potri.001G374800 [exp]	57.34	0.9578

Compare expression of checked genes

Potri.011G111101 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.